DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Mapk9

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001157143.1 Gene:Mapk9 / 26420 MGIID:1346862 Length:423 Species:Mus musculus


Alignment Length:368 Identity:146/368 - (39%)
Similarity:212/368 - (57%) Gaps:36/368 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKV--RLRGTENYFAMKRLMRPFEREEDAKGTY 65
            :|..|.:.:|.:.....|:.::.:|.|:.|.|...  .:.|..  .|:|:|.|||:.:..||..|
Mouse     9 QFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGIN--VAVKKLSRPFQNQTHAKRAY 71

  Fly    66 REIRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADL----HRYSRSKRMSDQEIRI 126
            ||:.|||.:||:|:||||||| .|...:.|||.||||..||||:|    |.....:|||     .
Mouse    72 RELVLLKCVNHKNIISLLNVF-TPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMS-----Y 130

  Fly   127 ILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSR-MCAD-KMTDHVGTMWYLAPE 189
            :|||:|.|:|::||||::||||||.||.|..:..::||||||:| .|.: .||.:|.|.:|.|||
Mouse   131 LLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPE 195

  Fly   190 IIFLRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRN 254
            :|...| |.:.:|:||||||:||::..:|||.|.:|:.|...:|..:|||:.||:..: ....||
Mouse   196 VILGMG-YKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKL-QPTVRN 258

  Fly   255 YLEGYPLRQRCDFHHLFMGY------------DVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRD 307
            |:|..|......|..||..:            ..||.||:.|||.:.|:|||:..||:.|||:..
Mouse   259 YVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITV 323

  Fly   308 LIEPHHHAEDTAP---VYDQNFENMVLPVKCWKELVSHEIRNF 347
            ..:|   ||..||   :||...|.....::.||||:..|:.::
Mouse   324 WYDP---AEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDW 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 146/367 (40%)
S_TKc 20..305 CDD:214567 129/304 (42%)
Mapk9NP_001157143.1 STKc_JNK 25..360 CDD:270840 142/347 (41%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.