DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Mapk13

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_036080.2 Gene:Mapk13 / 26415 MGIID:1346864 Length:366 Species:Mus musculus


Alignment Length:346 Identity:144/346 - (41%)
Similarity:214/346 - (61%) Gaps:3/346 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREI 68
            |.:..||::.||.|..|.....:|.|::|.|.....:.|....|:|:|.|||:.|..||..|||:
Mouse     9 FYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYREL 73

  Fly    69 RLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILR 133
            .|||||:|.|||.||:|| .||.::..|...|||...|..||.:. .....|:.:::.::||:|:
Mouse    74 LLLKHMHHENVIGLLDVF-TPASSLRSFHDFYLVMPFMQTDLQKI-MGMEFSEDKVQYLVYQMLK 136

  Fly   134 GLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYT 198
            |||||||||:|||||||.|:|||.:.|::||||||:|....:||.:|.|.||.|||:|.....|.
Mouse   137 GLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMTGYVVTRWYRAPEVILSWMHYN 201

  Fly   199 KAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQ 263
            :.:|:||||||:||::|.:.||:|::|:.|:..::.:.|.|..||:..:..:.:::|::..|...
Mouse   202 QTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLKDKAAKSYIQSLPQSP 266

  Fly   264 RCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPVYDQNFEN 328
            :.||..||.....||.||::||||:..:||:|||:|:.||:.....:|....|...| :|...|:
Mouse   267 KKDFTQLFPRASPQAADLLDKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQQP-FDDALEH 330

  Fly   329 MVLPVKCWKELVSHEIRNFRP 349
            ..|.|..||:.:..||.||.|
Mouse   331 EKLSVDEWKQHIYKEISNFSP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 143/344 (42%)
S_TKc 20..305 CDD:214567 124/284 (44%)
Mapk13NP_036080.2 STKc_p38delta 9..351 CDD:143384 143/344 (42%)
S_TKc 30..308 CDD:214567 123/279 (44%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.