DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and pmk1

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_595289.1 Gene:pmk1 / 2539920 PomBaseID:SPBC119.08 Length:422 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:130/355 - (36%)
Similarity:204/355 - (57%) Gaps:27/355 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENY--FAMKRLMRPFEREEDAKGTYREIRLLK 72
            |:.::..|: ::.|:.||.|::|.|...|...:::.  .|:|::...|.:....|...|||:||.
pombe    12 NQEMYVEPN-FKVVKELGQGAYGIVCAARNVASKDQEAVAIKKITNVFSKSILTKRALREIKLLI 75

  Fly    73 HM-NHRNVISL--LNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRS-KRMSDQEIRIILYQILR 133
            |. ||||:..:  |::.:|     ..|.:||:...||:|||:...:| :.::|...:..:||||.
pombe    76 HFRNHRNITCIYDLDIINP-----YNFNEVYIYEELMEADLNAIIKSGQPLTDAHFQSFIYQILC 135

  Fly   134 GLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK-------MTDHVGTMWYLAPEII 191
            ||||||||.|:||||||.|:.||.:.|::|.||||:|.|::.       ||::|.|.||.||||:
pombe   136 GLKYIHSANVIHRDLKPGNLLVNADCELKICDFGLARGCSENPEENPGFMTEYVATRWYRAPEIM 200

  Fly   192 FLRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYL 256
            .....|.|.|||||||||||||:....||:|:::|.|:..:::.:|||..|.::.||..|::.|:
pombe   201 LSFSSYHKGIDVWSVGCILAELLGGTPLFKGKDFVHQLNLILHQLGTPDEETLSHISSSRAQEYV 265

  Fly   257 EGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV 321
            ...|.::...|...|...:..|:||:.|:|...|.:||:..:|:.||||....:|     ...||
pombe   266 RSLPKQRPIPFETNFPKANPLALDLLAKLLAFDPNRRISVDDALEHPYLAVWHDP-----SDEPV 325

  Fly   322 YDQNFENMVLPVKCWKEL---VSHEIRNFR 348
            .|..|:.....::...||   :..|:.|||
pombe   326 CDSVFDFSFEYIEDANELRRVILDEVLNFR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 130/355 (37%)
S_TKc 20..305 CDD:214567 115/297 (39%)
pmk1NP_595289.1 STKc_MPK1 20..351 CDD:173750 124/341 (36%)
S_TKc 21..314 CDD:214567 115/297 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.