DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Y51B9A.9

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_496002.1 Gene:Y51B9A.9 / 174489 WormBaseID:WBGene00013091 Length:381 Species:Caenorhabditis elegans


Alignment Length:338 Identity:86/338 - (25%)
Similarity:163/338 - (48%) Gaps:48/338 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVRVAINESLWEFPDIY------EFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRP--FEREED 60
            |.:..:||.|:..|:.|      :|...:...:|.|:::.|:       .:|:::.|  |:..:.
 Worm     2 FRQEILNEVLFIVPNRYVDLLPSQFGNAMEVIAFDQISERRV-------VIKKVVLPENFDNWQH 59

  Fly    61 AKGTYREIRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRY--SRSKRMSDQE 123
            .:...||:....|:...|.:.:.::: .....:.|.::.|.|...||.:|..:  |..:::..:.
 Worm    60 WRRAQRELFCTLHIQEENFVKMYSIY-TWVETVEEMREFYTVREYMDWNLRNFILSTPEKLDHKV 123

  Fly   124 IRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFG-LSRMCADKMTDHVGTMWYLA 187
            |:.|.:.:...::|:||..|.||||||.|:.:|..:..:|..|. .:|......|.::...:|.|
 Worm   124 IKSIFFDVCLAVQYMHSIRVGHRDLKPENVLINYEAIAKISGFAHANREDPFVNTPYIVQRFYRA 188

  Fly   188 PEIIFLRGQYTK-AIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTP-----------T 240
            |||:.......| ::|:||:|||||||:|.::||.|:..:.|...::..:|.|           .
 Worm   189 PEILCETMDNNKPSVDIWSLGCILAELLTGKILFTGQTQIDQFFQIVRFLGNPDLSFYMQMPDSA 253

  Fly   241 REFITGISM---ERSRNYLEGYPLRQRCDFHHLFMGYDVQ-------AIDLMEKMLEMVPEKRIT 295
            |.|..|:.|   ::..|..|.:|       :.||:...:.       |.||:.:||.:.|:.||.
 Worm   254 RTFFLGLPMNQYQKPTNIHEHFP-------NSLFLDTMISEPIDCDLARDLLFRMLVINPDDRID 311

  Fly   296 AAEAMLHPYLRDL 308
            ..:.::||||.::
 Worm   312 IQKILVHPYLEEV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 86/338 (25%)
S_TKc 20..305 CDD:214567 79/317 (25%)
Y51B9A.9NP_496002.1 PKc_like 17..325 CDD:389743 81/323 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.