DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and UHMK1

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_787062.1 Gene:UHMK1 / 127933 HGNCID:19683 Length:419 Species:Homo sapiens


Alignment Length:387 Identity:95/387 - (24%)
Similarity:153/387 - (39%) Gaps:97/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENY--FAMKRLMRP---------- 54
            |.|:..        |..:::....||.||...|.:||..|....  .|:|:.:.|          
Human    13 PRFLEA--------FGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAA 69

  Fly    55 ---FEREEDAKGTYREIRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMD---ADLHRY 113
               |.:|..|        |.:...|||:::|..||  ..|.........|:..|:|   ::|..|
Human    70 EYGFRKERAA--------LEQLQGHRNIVTLYGVF--TIHFSPNVPSRCLLLELLDVSVSELLLY 124

  Fly   114 SRSKRMSDQEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSE-VRILDFGLSRMCADKMT 177
            |..:..|...|:.....:|..|.::|..|.||.||||.||..:..:| .:::|||||....::..
Human   125 SSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDV 189

  Fly   178 DHVGTMWYLAPE-----IIFLRG-----QYTKAIDVWSVGCILAELITDRVL---FRGENYVSQI 229
            .::.|..|.|||     .:...|     :.|.|:|:||:|.||.|:.:...|   .|.:.:.:..
Human   190 KYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANS 254

  Fly   230 RCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRI 294
            ..:|:.:      |.:...:..:   :..|.||                 ||::.||...|.:||
Human   255 SAIIDHI------FASKAVVNAA---IPAYHLR-----------------DLIKSMLHDDPSRRI 293

  Fly   295 TAAEAMLHPYLRDLIEPHHHAED----TAPVY-------------DQNFENMVLPVK--CWK 337
            .|..|:..|:......|  |.||    ..||.             ::.:|::|..||  |.|
Human   294 PAEMALCSPFFSIPFAP--HIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 94/385 (24%)
S_TKc 20..305 CDD:214567 80/316 (25%)
UHMK1NP_787062.1 STKc_KIS 22..308 CDD:270922 80/321 (25%)
RRM_SF 318..405 CDD:418427 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.