DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and mapk4

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_004910415.1 Gene:mapk4 / 100498202 XenbaseID:XB-GENE-484178 Length:577 Species:Xenopus tropicalis


Alignment Length:330 Identity:105/330 - (31%)
Similarity:167/330 - (50%) Gaps:46/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVRF--LGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            ||.|  ||.|:.|.|............|:|::  ........|...|||::::.:||.|::.:..
 Frog    20 FVDFKPLGFGANGLVLSAVDSKNSRRVAVKKI--AISDGRSMKHALREIKIIRRLNHDNIVKVHA 82

  Fly    85 VFHPPAHNM----MEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILRGLKYIHSAGVVH 145
            |..|...::    :::..||:|...|:.||.:......:::...::.:||:|||||||||..|:|
 Frog    83 VLGPRGADLQGDILKYNLVYIVQEHMETDLAQLLEQGPLTEDHAKLFMYQLLRGLKYIHSTNVLH 147

  Fly   146 RDLKPCNIAVNGNS-EVRILDFGLSRMCADKMTDHVG-------TMWYLAPEIIFLRGQYTKAID 202
            |||||.||.::... .::|.||||:|: .|:...|.|       |.||.:|.::.....||||||
 Frog   148 RDLKPANIFISTEELLLKIGDFGLARI-VDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAID 211

  Fly   203 VWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTRE-----------FITGISMERSRNYL 256
            :|:.||||||::|.|:||.|.:.:.|::.:::.:.....|           ||.. |.|..:   
 Frog   212 MWAAGCILAEMLTGRMLFAGSHELEQMQLILDTIPVIHEEDKEELLKVMPSFINA-SWEVRK--- 272

  Fly   257 EGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV 321
               |||:      |....:.:|||.:||:|...|..|:||..|:.|||:    .|:...|| .|:
 Frog   273 ---PLRK------LLPEMNSEAIDFLEKILTFNPMDRLTAEAALQHPYM----SPYSCPED-EPI 323

  Fly   322 YDQNF 326
            ....|
 Frog   324 SQHPF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 105/330 (32%)
S_TKc 20..305 CDD:214567 99/307 (32%)
mapk4XP_004910415.1 STKc_MAPK4_6 14..351 CDD:143359 105/330 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.