DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and mapk13

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_031751532.1 Gene:mapk13 / 100144715 XenbaseID:XB-GENE-490713 Length:377 Species:Xenopus tropicalis


Alignment Length:350 Identity:145/350 - (41%)
Similarity:214/350 - (61%) Gaps:8/350 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYRE 67
            :|.:..:|::|||.|..|..:..:|.|::|.|.......|....|:|:|.|||:.|..||..:||
 Frog     8 KFRKEEVNKTLWEIPLRYASLCLVGSGAYGSVCSAIDLKTGEKVAIKKLSRPFQSEIFAKRAFRE 72

  Fly    68 IRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQIL 132
            :.|||||||.|||.||:|| ..|.:..:|...|||...|..||.:. ....:|:.:::.::||:|
 Frog    73 LTLLKHMNHENVIGLLDVF-TSATSFNDFHNFYLVMPYMQIDLQKI-MGHHLSEDKVQYLVYQML 135

  Fly   133 RGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQY 197
            .||||||:||::||||||.|:|||.:.|::||||||:|....:||.:|.|.||.|||:|.....|
 Frog   136 CGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILNWMHY 200

  Fly   198 TKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLR 262
            .|.:|:||||||:.|::|.:.||:|::|:.|:..::.:.|.|..|||..:....::.|::..|..
 Frog   201 NKTVDIWSVGCIMGEMLTGKTLFKGKDYLDQLTQILKVTGVPGPEFIQKLEDMAAKKYIQSLPKI 265

  Fly   263 QRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDT-APVYDQNF 326
            .:.:|..||......|:||:|||||:..|||:||.||:.|||..:.   |...|:| ||.||.:.
 Frog   266 PKKEFSLLFPNASDLAVDLLEKMLELDVEKRLTATEALEHPYFDEF---HDADEETEAPPYDDSL 327

  Fly   327 ENMVLPVKCW--KELVSHEIRNFRP 349
            |...|.|:.|  ||....|:.|:.|
 Frog   328 EGEKLSVEEWRSKEYTYEEVINYTP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 144/347 (41%)
S_TKc 20..305 CDD:214567 122/284 (43%)
mapk13XP_031751532.1 STKc_p38delta 9..352 CDD:143384 144/347 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.