DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33337 and CG30467

DIOPT Version :9

Sequence 1:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:164 Identity:33/164 - (20%)
Similarity:55/164 - (33%) Gaps:46/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ILKRILNVS----IPSTAMSISDDSCQTAESEPWSGLTILTIVILSLM--GVIVAIATLYDYFLV 231
            |||.::.|.    ..:....:.||.|:.     |. :::...|:..|:  |.|..|.    |.||
  Fly    81 ILKTVMRVGELLRHSTLDQQLEDDLCKV-----WD-MSVSPEVVTLLLENGAIDPIM----YTLV 135

  Fly   232 KSQDQLHTAVKLFSARANSCA-----------------LFRIVVNQSNPNVIE-----------C 268
            ...:.:.....|.....|.||                 ||::........:|:           .
  Fly   136 AGCEDVRLYEILIGLLGNMCAQVECAEILACDRYTLETLFKMTYCMDTAMLIQLMRLFQYIMAHV 200

  Fly   269 LHGIRCMSLFWVVWIHQYDNVFSAPNINRFRFLS 302
            |.|....::.|.:....::|  ||.|:.|...||
  Fly   201 LSGKEKFAVNWYICFAAFEN--SAQNLGRILQLS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33337NP_996269.2 NRF 85..196 CDD:214781 7/26 (27%)
Acyl_transf_3 266..645 CDD:280013 11/48 (23%)
OafA 300..666 CDD:224748 2/3 (67%)
CG30467NP_611044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.