DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33337 and oac-2

DIOPT Version :9

Sequence 1:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_001309470.1 Gene:oac-2 / 3565938 WormBaseID:WBGene00044088 Length:645 Species:Caenorhabditis elegans


Alignment Length:389 Identity:91/389 - (23%)
Similarity:144/389 - (37%) Gaps:111/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 IECLHGIRCMSLFWVVWIHQYDNVFSAPNINRFRFLSWLQTPFTMFFLEGNFSVDSFFFIGGFLV 330
            |:||.||..:|:|                  .|..|..|       ||.|...||.||.|.|:|:
 Worm     5 IQCLRGIAIISVF------------------LFHLLPSL-------FLNGFLGVDIFFVISGYLI 44

  Fly   331 SLNALGTMEKNNGKINVPRMYIRRFIRIFPILAMSI-----LVYTQLTGVLGDGPLFKGGYSKKA 390
            |.:.  |..|.....:..|.|.|||.||.|:..::|     :|:..|..:|.|.       :.:.
 Worm    45 SKSL--TKSKITPIHDFLRFYYRRFRRILPLYYLTIFLIVVMVHQWLPYILWDN-------NYRY 100

  Fly   391 SCAKTWYMTLLFVVNFANDM------------CLDHTWYLAVDMQLFLISPILLFALY----KWG 439
            |.|....:|...|::...|.            ...|.|.|:::||.:|.:|.:.|.|.    |:.
 Worm   101 SIASLLLITNQLVIHDQADYFNSFQAASTAINAFLHLWSLSLEMQFYLFAPCIFFMLQFLNSKYL 165

  Fly   440 KKAAA----AIGVL--IVLLSGCLFATMMVNHYSIKS-------------LDFSLQKKTYFYTHT 485
            |..||    .||.:  .::|....|..|::..:...:             :|...:.||...|.|
 Worm   166 KLLAAILTNTIGFVCFALVLDSFAFNFMLLRLWQFSAGFTALYWSMAEAKIDECEKSKTSAPTRT 230

  Fly   486 HAAPWLIGFLYGYFVFLNKGRKFKMNWIAVWSGWILCLAMLFTSIFALYPKLESGKPWLMTTLEV 550
            :....:...|....|.|   ..:|:|        :|....|.|.:.|...||||....::.: :.
 Worm   231 YNDDLVTVALVVLGVCL---LPYKIN--------VLLTRPLVTVVTAFIIKLESESNQILNS-KT 283

  Fly   551 SSY-----YTLTRVGWPMAVGWVVFACMQGYGGMANTFLSSP----LWQPISKLSYSIYIWHSF 605
            .||     |.:..|.||                :.:.||||.    ::..::.:..||.:.|.|
 Worm   284 LSYIGDISYVMYLVHWP----------------IISIFLSSNVNSYVFCVVTTILVSIALHHIF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33337NP_996269.2 NRF 85..196 CDD:214781
Acyl_transf_3 266..645 CDD:280013 91/389 (23%)
OafA 300..666 CDD:224748 83/355 (23%)
oac-2NP_001309470.1 OafA 4..353 CDD:224748 91/389 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.