DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33337 and CG9447

DIOPT Version :9

Sequence 1:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster


Alignment Length:663 Identity:148/663 - (22%)
Similarity:259/663 - (39%) Gaps:120/663 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VYDLGNFDECINIKKDSIRGKYC--FLDVSPAKILGVESSLAGIL--------------KIKTAT 155
            :|.|.::|.|:    |:..|.||  ::::.|    ...|:|...:              ::....
  Fly     4 LYQLDDYDLCL----DNQAGTYCLVYVEILP----NASSALWHQIDQVSQDSKHRFRHDRVFRGV 60

  Fly   156 CFPASCS--ATHMNKFVDTILKRILNVSIPS--------TAMSISDD--------SCQTAE-SEP 201
            |. .||.  ..|:::|.:...:.||:..:.|        .||:...|        .|...: ||.
  Fly    61 CL-ESCKQRINHLSEFREYEKEEILDKELISYYDKVHRRDAMNSDRDLFNKEVVKGCLNQKFSEK 124

  Fly   202 WSGLT---------------ILTIVILSLMGVIVAI------ATLYDYFLVKSQDQLHTAV---K 242
            :|..|               .:.::.|:..|::|.|      ::..||.|.|...|...:.   .
  Fly   125 FSLRTRSLIEYCVSASDKDLKMDLLDLAFYGILVVILFITLCSSFLDYRLSKMNSQKSESFYREP 189

  Fly   243 LFSARANSCALFRIV---------VNQSNPNVIECLHGIRCMSLFWVVWIHQYDNVFSAPNINRF 298
            |...|......|.:|         .|......:....|.|.:.:|.|:..|......:.|..|..
  Fly   190 LMDRRQRLLTSFSVVRNYHRLVEPYNSDFSRDVSFFDGFRVIGVFVVILGHTLMVFMTVPIENPE 254

  Fly   299 RFLSWLQTPFTMFFLEGNFSVDSFFFIGGFL--VSLNALGTMEKNNGKINVPRMYIR----RFIR 357
            .|..:|....|..|..|:..:..||.:.|||  |.......::...|.:....:|.|    |:.|
  Fly   255 FFEQFLFRFETSIFQNGSLVIQIFFVMSGFLLYVKFTKRQQIQPKTGTLECIAVYFRVFSYRYFR 319

  Fly   358 IFPILAMSILVYTQLTGVLGDGPLFKG-GYSKKASCAKTWYMTLLFVVN-FANDMCLDHTWYLAV 420
            :.|.|...||....|...|.:||.::. ..:::..|...|:..:.||.| ...|.|...||||..
  Fly   320 LLPSLLALILFNGTLLVRLQNGPFWRHLTEAERVFCRANWWKNVFFVTNHMLEDSCSHQTWYLGA 384

  Fly   421 DMQLFLISPILLFALYKWGKKAAAAIGVLIVLLSGCLFATMMVNHYSIKSLD--FSLQKKTYFYT 483
            |||||.:..|::....|..|........|:.|    .||...|..| :..||  :.::.:||.|.
  Fly   385 DMQLFELFLIVIIITKKHPKLTRTIYTTLLAL----AFAVPAVLTY-VLELDGIYHIRPETYRYL 444

  Fly   484 ---------------HTHAAPWLIGFLYGYFVFLNKGRKFKMNW-----IAVWSGWILCLAMLFT 528
                           :|:...:|.|||.|:|....:....::..     :|:|...:..|.:||:
  Fly   445 YFRHSDTFYQMYPPFYTNLGGYLFGFLCGHFYLRQRSGNVELLGHLKYDLAMWLLVLATLGVLFS 509

  Fly   529 SIFALYPKLESGKPWLMTTLEVSSYYTLTRVGWPM-AVGWVVFACMQGYGGMANTFLSSPLWQPI 592
            ..  ::.:.:..||.|...|    |..:.::.|.: ..|:|:..|.: .||:|..|.:.|.::|:
  Fly   510 GY--IFIRQDFAKPSLWLAL----YAGIHKILWVLICAGFVILMCRK-VGGIAYDFCTLPAFRPL 567

  Fly   593 SKLSYSIYIWHSFIQEINKRIVRTNTYFSNYQVMLNFWSTMGFTVLFSYLLYLLIEAPIGGLDRL 657
            :::|:..::||..:........|...|.|::.::.|.:|....|...:.|:.:|:|.|...:.|.
  Fly   568 ARISFQSFLWHIVVLRTVAGNFRQPVYVSSFFLLCNVFSVFILTQFVAALVAVLLEYPFVEVLRC 632

  Fly   658 LRPKKKAPAENKP 670
            |...:|.|.|..|
  Fly   633 LIKPEKGPEEVGP 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33337NP_996269.2 NRF 85..196 CDD:214781 23/122 (19%)
Acyl_transf_3 266..645 CDD:280013 98/409 (24%)
OafA 300..666 CDD:224748 97/396 (24%)
CG9447NP_610243.4 Acyl_transf_3 222..611 CDD:280013 96/400 (24%)
OafA 225..631 CDD:224748 101/417 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.