DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33337 and oac-40

DIOPT Version :9

Sequence 1:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_505333.1 Gene:oac-40 / 179279 WormBaseID:WBGene00019849 Length:642 Species:Caenorhabditis elegans


Alignment Length:593 Identity:115/593 - (19%)
Similarity:188/593 - (31%) Gaps:228/593 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 IECLHGIRCMSLFWVVWIHQYDNVFS-APNINRFRFLSWLQTPFTMFFLEGNFSVDSFFFIGGFL 329
            |:||.||..:.:|          :|. .||:                |:.|...||.||.|.|||
 Worm     5 IQCLRGIAIILVF----------LFHLLPNL----------------FVNGFLGVDIFFVISGFL 43

  Fly   330 VSLNALGTMEKNNGKINVPRMYIRRFIRI-----FPILAMSILVYTQLTGVLGDGPLFKGGYSKK 389
            ::  .:.|........::...|.|||.||     |.|....|:::..|       |.|....:.:
 Worm    44 MA--KILTKSSLRSVQDITAFYFRRFRRILTLYLFTIFLTVIMIHLYL-------PNFLWETNNR 99

  Fly   390 ASCAKTWYMTLLFVV------------NFANDMCLDHTWYLAVDMQLFLISPILLFALYKWGKKA 442
            .|.|..:.:|...|:            :.::.....|.|.|:|:||.::::||:.|.|.......
 Worm   100 YSLASLFLVTNQLVIHDQADYFNEFRTSLSSSNAFLHLWSLSVEMQFYILAPIVFFGLQFLKNDY 164

  Fly   443 AAAIGVLIVLLSGCLFATMMVNHYSIKSLDFSLQKKTYFYTHTHAAPWLIGFLYGYF-------- 499
            ...:.|.|..:.|.:...::.:.:   :.:|.|.:...|..         ||:..::        
 Worm   165 LKLVAVSITSVVGFICFVLIFDQF---AFNFMLLRLWQFSA---------GFVSLFWSKIRVNRL 217

  Fly   500 ---VFLNKGRKFKMNW---------IAVWSGWILCLAMLFTSIFALYPKLESGKPWLMTTL---- 548
               :..|:.|.|:..:         |||..   ||.......:..|.|        |:||.    
 Worm   218 PNKIEENETRLFEFPFLKEDMVIILIAVIG---LCFIPTKLDVLILRP--------LVTTATALI 271

  Fly   549 -------------EVSSY-----YTLTRVGWPM-------AVGWVVFACMQGYGGMANTFLSSPL 588
                         ::..|     |.:..|.||:       .|...:|.       .:.|.|||.:
 Worm   272 IGCEYHNNQILKSKILGYIGDISYVMYLVHWPIITIFLSNTVKSYIFC-------TSLTILSSVV 329

  Fly   589 -------------WQPI-----------SKLSYSI---YIWHSFIQE------INKRIVRTNTYF 620
                         |:.:           :.|.||:   ..|...|.|      .|.:|:..|.:.
 Worm   330 LHHTFEKLYLKLNWKSLICLLFALIHCNAYLQYSVREHNFWKDQIPEELQETVSNNQIILANQFK 394

  Fly   621 SNYQVM---LNFWS--------------------TMG--------------FTVLFSYLLYLLIE 648
            .||.|.   .||..                    |:|              |.:.:|...|:.|:
 Worm   395 LNYCVQGDTSNFKENIRIFGYCKYPQGRGNVSIMTIGNSYALSFADLIIEQFKLNYSNYTYVSID 459

  Fly   649 APIG------GLDRLLRPKKKAPAENKPMTNSDRVGEGHGHDV-------DLSNQRELEGNDSSA 700
            ...|      |....|...:|..||:||             |:       ..|.|..:..||...
 Worm   460 EGYGFFTDSPGSSLALSVFRKLVAEHKP-------------DILFITPRYSSSLQSRIRKNDDYI 511

  Fly   701 DQLAEKSQ 708
            .|::|..|
 Worm   512 HQMSENIQ 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33337NP_996269.2 NRF 85..196 CDD:214781
Acyl_transf_3 266..645 CDD:280013 97/515 (19%)
OafA 300..666 CDD:224748 94/507 (19%)
oac-40NP_505333.1 OafA 1..341 CDD:224748 78/400 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.