DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and rad51

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001016393.1 Gene:rad51 / 549147 XenbaseID:XB-GENE-1016881 Length:336 Species:Xenopus tropicalis


Alignment Length:46 Identity:15/46 - (32%)
Similarity:20/46 - (43%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 FSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEPPKSL 214
            |..|::.|   |:...|.||.:.|||  ..|.:....|...|.|.|
 Frog    17 FGPQAISR---LEQCGINANDVKKLE--EAGFHTVEAVAYAPKKEL 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 4/12 (33%)
P53_C 429..495 CDD:288471
rad51NP_001016393.1 recomb_RAD51 22..336 CDD:274048 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9868
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002925
OrthoInspector 1 1.000 - - otm48487
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
66.010

Return to query results.
Submit another query.