powered by:
Protein Alignment p53 and rad51
DIOPT Version :9
Sequence 1: | NP_996267.1 |
Gene: | p53 / 2768677 |
FlyBaseID: | FBgn0039044 |
Length: | 495 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016393.1 |
Gene: | rad51 / 549147 |
XenbaseID: | XB-GENE-1016881 |
Length: | 336 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 15/46 - (32%) |
Similarity: | 20/46 - (43%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 FSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEPPKSL 214
|..|::.| |:...|.||.:.||| ..|.:....|...|.|.|
Frog 17 FGPQAISR---LEQCGINANDVKKLE--EAGFHTVEAVAYAPKKEL 57
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
p53 | NP_996267.1 |
P53 |
203..383 |
CDD:176262 |
4/12 (33%) |
P53_C |
429..495 |
CDD:288471 |
|
rad51 | NP_001016393.1 |
recomb_RAD51 |
22..336 |
CDD:274048 |
13/41 (32%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
65 |
1.000 |
Domainoid score |
I9868 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
69 |
1.000 |
Inparanoid score |
I5160 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002925 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48487 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X6184 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 6.010 |
|
Return to query results.
Submit another query.