DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and tp73

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_899183.1 Gene:tp73 / 368221 ZFINID:ZDB-GENE-030814-2 Length:640 Species:Danio rerio


Alignment Length:370 Identity:83/370 - (22%)
Similarity:132/370 - (35%) Gaps:103/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FNLPQSFGNESNEYAHLATPVDPAYGGN-----------------NTNNMMQFTNNLEILANNNS 106
            |.|||:  ..|.:.|..:.|      ||                 |.|.|.|::     |.:::.
Zfish    27 FELPQA--GHSGDRASSSLP------GNRAEVCMDVYHMRDMRDMNDNVMSQYS-----LLSSSM 78

  Fly   107 DGNNKINACNKFVCHKGTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQ 171
            |              :|..:...||.       |.:.|.:.:..|..|              :||
Zfish    79 D--------------QGLGNRAASTS-------PYSSETTSNVPTPSP--------------YSQ 108

  Fly   172 QSVLREMMLQDIQIQANT-LPKLENHNIGGYCFSMVLDE---PPKSLWMYSIPLNKLYIRMNKAF 232
            .:...|.|.....|.:|| .|       |.:.|.:...:   ...:.|.||..|.|||.::.|..
Zfish   109 PNSTFEAMSPAPAIPSNTDYP-------GPHNFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTC 166

  Fly   233 NVDVQFKSKMP------IQPLNLRVFLCFSNDVSAPVVRCQNHLSVEPLTANNAKMRESLLRSEN 291
            .:.::..|..|      ..|:..:     :..|:..|.||.||........:.......|:|.|.
Zfish   167 PIQIKLASSPPNGSVIRAMPIYKK-----AEHVTEVVKRCPNHKLGRDFNESQTAPASHLIRVEG 226

  Fly   292 PNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG---RKETSLVFCL 353
            .|  .|...... ::.|.||:||...    .:.|....|:.:.|:|.:||:|   |:...::..|
Zfish   227 NN--LCQYVDDP-VTGRQSVLVPYES----PQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITL 284

  Fly   354 EKACGDIVGQHVIHVKICTCPKRDRIQDE------RQLNSKKRKS 392
            |...|.::|:.....:||.||.|||..||      :.||....|:
Zfish   285 ETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQQALNESVAKN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 49/197 (25%)
P53_C 429..495 CDD:288471
tp73NP_899183.1 P53 120..316 CDD:279242 54/214 (25%)
P53_tetramer 352..391 CDD:285011
SAM_superfamily 498..557 CDD:301707
SAM 498..556 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580494
Domainoid 1 1.000 66 1.000 Domainoid score I9916
eggNOG 1 0.900 - - E1_2C1DX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.