DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and tp63

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_694518.1 Gene:tp63 / 260407 ZFINID:ZDB-GENE-030819-1 Length:588 Species:Danio rerio


Alignment Length:393 Identity:86/393 - (21%)
Similarity:135/393 - (34%) Gaps:132/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLPQSFGNESNEYAHLATPVDPAYGGNNTNNMMQFTNNLEILANNNSDGNNKINACNKFVCHKGT 124
            |.|.|:.........|...:|...|..:|:            ..||....|.:.|.:.:      
Zfish     7 NAPSSYSEPQYTSLGLLNSMDQNGGSTSTS------------PYNNDHAQNNVTAPSPY------ 53

  Fly   125 DSEDDST--EVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQQSVLREMMLQDIQIQA 187
             ::..||  .:.....||...:.:|      |..|                        |:..|.
Zfish    54 -AQPSSTFEALSPSPAIPSNTDYAG------PHTF------------------------DVSFQQ 87

  Fly   188 NTLPKLENHNIGGYCFSMVLDEPPKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVF 252
            ::..|                   .:.|.||..|.|||.::.|...:.::..:..| |...:|..
Zfish    88 SSTAK-------------------SATWTYSTELKKLYCQIAKTCPIQIKVLTNPP-QGAVIRAM 132

  Fly   253 LCF--SNDVSAPVVRCQNH-LSVEPLTANNAKMR--ESLLRSENPNSVYCGNAQGK----GISER 308
            ..:  :..|:..|.||.|| ||.|   .|:.::.  ..|:|.|       ||:..:    .|:.|
Zfish   133 PVYKKAEHVTEVVKRCPNHELSRE---FNDGQIAPPSHLIRVE-------GNSHAQYVEDSITGR 187

  Fly   309 FSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG---RKETSLVFCLEKACGDIVGQHVIHVKI 370
            .||:||.    ...:.|....|:.:.|:|.:||:|   |:...::..||...|.::|:.....:|
Zfish   188 QSVLVPY----EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARI 248

  Fly   371 CTCPKRDRIQDE-------------------------RQLNS-KKRKSVPEAAEEDEPSKVRRCI 409
            |.||.|||..||                         .|||| |||:|..|..         .|:
Zfish   249 CACPGRDRKADEDSIRKQHVTDGTKSSEAFRQASSHLSQLNSIKKRRSTDEEV---------FCL 304

  Fly   410 AIK 412
            .||
Zfish   305 PIK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 53/216 (25%)
P53_C 429..495 CDD:288471
tp63NP_694518.1 P53 67..262 CDD:279242 61/258 (24%)
P53_tetramer 292..332 CDD:285011 8/25 (32%)
SAM_tumor-p63 449..513 CDD:188971
SAM 453..513 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580495
Domainoid 1 1.000 66 1.000 Domainoid score I9916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002925
OrthoInspector 1 1.000 - - otm25509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.