DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and Trp73

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006538783.2 Gene:Trp73 / 22062 MGIID:1336991 Length:649 Species:Mus musculus


Alignment Length:412 Identity:97/412 - (23%)
Similarity:153/412 - (37%) Gaps:77/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HKGTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQ----------------- 168
            |..:..|.|||..|:.:....|.|.||||.:...:..|||:...||:.                 
Mouse    32 HLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGMAQFNLLSSAMDQMGSRAAPASPYT 96

  Fly   169 ------------FSQQSVLREMMLQDIQIQANT-LPKLENHNIGGYCFSMVLDE---PPKSLWMY 217
                        ::|.|...:.|.....|.:|| .|       |.:.|.:...:   ...:.|.|
Mouse    97 PEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYP-------GPHHFEVTFQQSSTAKSATWTY 154

  Fly   218 SIPLNKLYIRMNKAFNVDVQFKSKMPIQP-LNLRVFLCF--SNDVSAPVVRCQNHLSVEPLTANN 279
            |..|.|||.::.|  ...:|.|...|..| ..:|....:  :..|:..|.||.||..........
Mouse   155 SPLLKKLYCQIAK--TCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDIVKRCPNHELGRDFNEGQ 217

  Fly   280 AKMRESLLRSENPN-SVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG 343
            :.....|:|.|..| :.|..:.    ::.|.|||||.    ...:.|....|:.:.|:|.:||:|
Mouse   218 SAPASHLIRVEGNNLAQYVDDP----VTGRQSVVVPY----EPPQVGTEFTTILYNFMCNSSCVG 274

  Fly   344 ---RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDE------RQLN--SKKRKSVPEAA 397
               |:...::..||...|.::|:.....:||.||.|||..||      :.||  :.|..:..:.|
Mouse   275 GMNRRPILVIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESTTKNGAASKRA 339

  Fly   398 EEDEPSKVRRCIAIKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIK 462
            .:..|.      ||....|.....|..|:.....:|.    |.....|....||.|  .:..::.
Mouse   340 FKQSPP------AIPALGTNVKKRRHGDEDMFYMHVR----GRENFEILMKVKESL--ELMELVP 392

  Fly   463 EAAAEVLRNPNQENLRRHANKL 484
            :...:..|...|:.|.:..:.|
Mouse   393 QPLVDSYRQQQQQQLLQRPSHL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 52/195 (27%)
P53_C 429..495 CDD:288471 10/56 (18%)
Trp73XP_006538783.2 P53 137..316 CDD:176262 50/188 (27%)
P53_tetramer 356..392 CDD:369476 8/41 (20%)
SAM_tumor-p73 499..563 CDD:188970
Gp37 558..>648 CDD:370600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836964
Domainoid 1 1.000 65 1.000 Domainoid score I9999
eggNOG 1 0.900 - - E1_2C1DX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43341
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.