DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and taf1

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_012824624.1 Gene:taf1 / 100496377 XenbaseID:XB-GENE-952372 Length:1949 Species:Xenopus tropicalis


Alignment Length:242 Identity:46/242 - (19%)
Similarity:91/242 - (37%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 DSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQQSVLREMMLQDIQIQANT 189
            :.|::..:..|..|..:.::|.|:::..           |..:..|...|.|:.::  ::.....
 Frog  1351 EQEEELEKTVIHNDNEELIKVEGTKIVL-----------GKQLIESADEVRRKSLV--LKFPKQQ 1402

  Fly   190 LPKLENHNIGGYCFSMVLDEPPKSLW-MYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFL 253
            ||:.:...:|.......|:.|.||:. ..:.|:..|...:....|......:..|          
 Frog  1403 LPQKKKRRVGSTVHCDYLNRPHKSIHRRRTDPMVTLSSVLESIINDMRDMPNTYP---------- 1457

  Fly   254 CFSNDVSAPVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMS 318
             |.:.|:|.||:....:.:.|:....  :||::.:...|:            .|.|...|.|.:.
 Frog  1458 -FHSPVNAKVVKDYYKIVINPMDLQT--LRENVRKRMYPS------------REEFREAVELIVK 1507

  Fly   319 RSVTRSG----LTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDIV 361
            .|:..:|    ||:...|...:|:.. :..||..|. .||||...::
 Frog  1508 NSILYNGPKHSLTQICQAMLELCEEK-LREKEDKLA-RLEKAINPLL 1552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 34/164 (21%)
P53_C 429..495 CDD:288471
taf1XP_012824624.1 TBP-binding 9..>41 CDD:286347
DUF3591 596..1059 CDD:288969
zf-CCHC_6 1314..1349 CDD:291934
Bromo_TFIID 1438..1549 CDD:99943 29/137 (21%)
Bromo_TFIID 1560..1671 CDD:99943
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C1DX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.