DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33333 and CG42834

DIOPT Version :10

Sequence 1:NP_996225.1 Gene:CG33333 / 2768672 FlyBaseID:FBgn0053333 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001189244.1 Gene:CG42834 / 10178910 FlyBaseID:FBgn0262023 Length:122 Species:Drosophila melanogaster


Alignment Length:108 Identity:39/108 - (36%)
Similarity:57/108 - (52%) Gaps:25/108 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIH------SGAPAAVISQGQQSVSQSVGSAYGQ- 58
            ||:..|.:|.|..|||||||:.|:.|::.|.:|      |||||..::|.:..|||:....||| 
  Fly     1 MALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGAPAVGVTQSRSVVSQAQRPNYGQR 65

  Fly    59 -------------DQGLAGARPYWAAPRPALAAPRPAESYARP 88
                         :..::|:||:..|||.:     .|.:||||
  Fly    66 SISGSIGGSRRVGEVPVSGSRPHGGAPRRS-----SASAYARP 103

Return to query results.
Submit another query.