DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxd and Nox4

DIOPT Version :9

Sequence 1:NP_001163633.1 Gene:Pxd / 2768671 FlyBaseID:FBgn0004577 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_006508075.1 Gene:Nox4 / 50490 MGIID:1354184 Length:617 Species:Mus musculus


Alignment Length:156 Identity:31/156 - (19%)
Similarity:51/156 - (32%) Gaps:62/156 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 NMLKNRLI---YKAPSGSYINDFDPNIDPSVLNEHATAAFRYFHSQIEGRLDLLSELRQVLGSLT 458
            ::::.|:|   :||..|.||....|::  |.|..|...            |.:|.:.|       
Mouse   320 DVMELRMIKENFKARPGQYIILHCPSV--SALENHPFT------------LTMLCQKR------- 363

  Fly   459 LSDWFNRPGII------EVGDNFDSLTRGHA-----TQPEELTDINF------------------ 494
            ...|.:|..|.      :...:.|:....||     |:.:....::|                  
Mouse   364 WQPWHSRVWIYSFFVCSDAACHEDTSKMNHAFLLCPTETKATFGVHFKVVGDWTERFRDLLLPPS 428

  Fly   495 --DRQIKHFLFRRNM-------PFGS 511
              |.:|..|:..||.       ||||
Mouse   429 SQDSEILPFIHSRNYPKLYIDGPFGS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxdNP_001163633.1 An_peroxidase 105..643 CDD:281139 31/156 (20%)
peroxinectin_like 260..638 CDD:188655 31/156 (20%)
Nox4XP_006508075.1 Ferric_reduct 69..204 CDD:366815
NOX_Duox_like_FAD_NADP 311..616 CDD:99783 31/156 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.