DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxd and Pxn

DIOPT Version :9

Sequence 1:NP_001163633.1 Gene:Pxd / 2768671 FlyBaseID:FBgn0004577 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster


Alignment Length:632 Identity:210/632 - (33%)
Similarity:314/632 - (49%) Gaps:71/632 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VCEKTAYRTLDGSCNHLEQPGLGVANSKYGRLLTPKYADGISAP---TRSV--TGDELPSARLVS 158
            :|..:.||::||:||:|:.|..|.:.:.:.||..|.|.:|.|.|   |:.:  :|...|||||||
  Fly   771 MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVS 835

  Fly   159 LVAFGEQDV-PDPEFTLHNMQWGQIMTHDMSMQAGGTQSKKHPTRCCTDDGRLIGLDTAHK---- 218
            ......::: ||...|...|||||.:.||:........|:...           |:|....    
  Fly   836 TSLVATKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWD-----------GIDCKKSCEMA 889

  Fly   219 -TCFAIIVPPHDPAYSQVGTECLNFVRTLTDRDS--------NCQYQGGPAEQLTVVTSYLDLSL 274
             .|:.|.|||:||...  ...|::.||:.....|        :.|::    ||:..:|||:|.|.
  Fly   890 PPCYPIEVPPNDPRVR--NRRCIDVVRSSAICGSGMTSLFFDSVQHR----EQINQLTSYIDASQ 948

  Fly   275 VYGNSIQQNSDIREF--QGG--RMIVEERNGAKWLPLSRNVTG-DCDA-VDASEV-CYRSGDVRV 332
            |||.|.....::|..  |.|  |:.|........||.:....| ||.. :|.:.: |:.|||:||
  Fly   949 VYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRV 1013

  Fly   333 NQNPGLAILQTILLREHNRIADALSALNPHYDDRTLFQEARKINIAQYQQISYYEWLPIFLG--G 395
            |:..||..:.||.:|||||||..|..:|.|:|..||:||||||..||.|.|::.:|||:.:|  |
  Fly  1014 NEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESG 1078

  Fly   396 ENMLKNRLIYKAPSGSYINDFDPNIDPSVLNEHATAAFRYFHSQIEGRLDLLSELRQVL--GSLT 458
            ..|:          |.| ..::|.::||:.||.||||.|:.|:.|...|..|:|..|.:  |.|.
  Fly  1079 MEMM----------GEY-QGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLL 1132

  Fly   459 LSDWFNRPGIIEVGDNFDSLTRGHATQPEEL--TDINFDRQIKHFLFRRNMPFGSDLRSLDIQRN 521
            |...|..|..:......|.|.||....|.:|  .|.|.:.::...||:.......||.:::|||.
  Fly  1133 LHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRG 1197

  Fly   522 RDHGLASYNDMREFCGLRRAHSWEGY-GDLISPPILEKLKSLYPSHEDVDLTVGASLEAHVAGAL 585
            ||||:..||..|:.|.|..|..:|.. |::.|..|.:|:|.||...::||:.:|..||..|.|..
  Fly  1198 RDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGK 1262

  Fly   586 AGPTFLCILTEQFYRTRVGDRFFFENGDKLTGFTPDQLEELRKASMARLLCDNGNHISSMQPEAF 650
            .||.|.|:|.|||.|.|.|||.::||...   |:|:||.::::|:..|:|||.|::...:....|
  Fly  1263 VGPLFQCLLVEQFRRLRDGDRLYYENPGV---FSPEQLTQIKQANFGRVLCDVGDNFDQVTENVF 1324

  Fly   651 RTVSHSNPIIPCSNIPQVDLTKWID-------QKLYATVDPSHYGKK 690
            ....|......|.:|..::|..|.:       ..::.:..|..|.|:
  Fly  1325 ILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIFDSYIPQTYTKR 1371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxdNP_001163633.1 An_peroxidase 105..643 CDD:281139 200/570 (35%)
peroxinectin_like 260..638 CDD:188655 148/391 (38%)
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139 200/570 (35%)
peroxidasin_like 898..1338 CDD:188658 162/459 (35%)
VWC 1465..1523 CDD:278520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454588
Domainoid 1 1.000 107 1.000 Domainoid score I2172
eggNOG 1 0.900 - - E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 1 1.000 - - FOG0000202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11475
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.