DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxd and Ptgs1

DIOPT Version :9

Sequence 1:NP_001163633.1 Gene:Pxd / 2768671 FlyBaseID:FBgn0004577 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_032995.1 Gene:Ptgs1 / 19224 MGIID:97797 Length:602 Species:Mus musculus


Alignment Length:403 Identity:99/403 - (24%)
Similarity:158/403 - (39%) Gaps:93/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 LDLSLVYGNSIQQNSDIREFQGGRMIVEERNGAKWLPLSRNVTGDCDAVDASEVCYR-------S 327
            :||..:||:::::...:|.|:.|::..:..:|..:.|          :|:.:.|..|       .
Mouse   230 VDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEVYPP----------SVEQASVLMRYPPGVPPE 284

  Fly   328 GDVRVNQN-----PGLAILQTILLREHNRIADALSALNPHYDDRTLFQEAR--------KINIAQ 379
            ..:.|.|.     |||.:..||.||||||:.|.|...:|.:||..|||..|        ||.|.:
Mouse   285 RQMAVGQEVFGLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEE 349

  Fly   380 Y-QQISYYEWLPIFLGGENMLKNRLIYKAPSGSYINDFDPNIDPSVLNEHATAAFRYFHSQIEGR 443
            | |.:|.| :|.:....|.:.:.:..|:.......|.. .:..|.:.|.....:..|.:.|....
Mouse   350 YVQHLSGY-FLQLKFDPELLFRAQFQYRNRIAMEFNHL-YHWHPLMPNSFQVGSQEYSYEQFLFN 412

  Fly   444 LDLLSELRQVLGSLTLSDWFN--RPGIIEVGDNFDSLTRGHATQPEELTDINFDRQIKHFLFRRN 506
            ..:|.:    .|...|.|.|:  |.|.|..|.|||.    |..  ....|:     ||.....|.
Mouse   413 TSMLVD----YGVEALVDAFSRQRAGRIGGGRNFDY----HVL--HVAVDV-----IKESREMRL 462

  Fly   507 MPFGSDLRSLDIQRNRDHGLASYNDMREFCGLRR--AHSWEGYGDL----ISPPILEKLKSLYPS 565
            .||.        :..:..||..|...:|..|.:.  |...|.|||:    ..|.:|  |:...|:
Mouse   463 QPFN--------EYRKRFGLKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLL--LEKCQPN 517

  Fly   566 H---EDVDLTVGASLEAHVAGALAGPTFLCILTEQFYR--TRVGDRFFFENGDKLTGFTPDQLEE 625
            .   |.: :.:||...  :.|.|..|    |.:.::::  |..||          .||     ..
Mouse   518 SIFGESM-IEMGAPFS--LKGLLGNP----ICSPEYWKPSTFGGD----------VGF-----NL 560

  Fly   626 LRKASMARLLCDN 638
            :..||:.:|:|.|
Mouse   561 VNTASLKKLVCLN 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxdNP_001163633.1 An_peroxidase 105..643 CDD:281139 99/403 (25%)
peroxinectin_like 260..638 CDD:188655 98/401 (24%)
Ptgs1NP_032995.1 EGF_CA 35..72 CDD:238011
prostaglandin_endoperoxide_synthase 92..578 CDD:188648 99/403 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.