DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr9 and Obscn

DIOPT Version :9

Sequence 1:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_038943147.1 Gene:Obscn / 338458 RGDID:631335 Length:9211 Species:Rattus norvegicus


Alignment Length:312 Identity:75/312 - (24%)
Similarity:109/312 - (34%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LEEARNAGPYF---DKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYT 309
            ::.:.:..|.|   .|||..:|    ||.|.|:|::  :||.|.  .|||.:.|.         .
  Rat     1 MDHSFSGAPRFLTRPKAFVVSV----GKDATLSCQI--VGNPTP--HVSWEKDRQ---------P 48

  Fly   310 YTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQV-STTPHMSHYIHLNVVEPSTEIIGAP-- 371
            ..:..|||.......  :.|.|......|||.|.|:. :........:.|.|....|....||  
  Rat    49 VEAGARFRLAQDGDV--YRLTILDLALGDSGQYVCRARNAIGEAFAAVGLRVDSEGTCAEQAPHF 111

  Fly   372 -----DLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTT 431
                 .:.:..|:.....|.:..||:|.  :.|:.:......|     |:|...|.   ::|:  
  Rat   112 LLRPTSIRVREGADATFRCRVGGSPQPA--VSWSKDGRRLGAP-----DAPHVRVE---DRGE-- 164

  Fly   432 TSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLS 496
            .|.|.|:||||.|.|.|:....|....:.....|...|.:.:.|.|      |||.::.|||   
  Rat   165 ASALRIRSARPRDGGTYEVRAENPLGSASAAAALVVDSDAEAAGPP------GTSVATLLAH--- 220

  Fly   497 VCVPVCVLLQLGACRWIAALLGAALATPPPLRSTRRATGERPGSPGCAPIAC 548
                    ||                   ..|...||.|..|..||.....|
  Rat   221 --------LQ-------------------QRREAMRAEGVPPSPPGAGTRTC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr9NP_001287332.1 Ig 263..361 CDD:299845 24/98 (24%)
IG_like 263..360 CDD:214653 24/97 (25%)
IG_like 371..464 CDD:214653 23/99 (23%)
IGc2 377..456 CDD:197706 22/78 (28%)
ObscnXP_038943147.1 Ig strand C' 2122..2125 CDD:409353
Ig strand D 2130..2135 CDD:409353
Ig strand E 2138..2143 CDD:409353
Ig strand F 2152..2158 CDD:409353
Ig strand G 2161..2169 CDD:409353
Ig 2187..2253 CDD:416386
Ig strand B 2196..2200 CDD:409353
Ig strand C 2209..2213 CDD:409353
Ig strand E 2234..2238 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2273..2353 CDD:416386
Ig strand A 2273..2275 CDD:409353
Ig strand A' 2278..2281 CDD:409353
Ig strand B 2285..2291 CDD:409353
Ig strand C 2298..2303 CDD:409353
Ig strand C' 2306..2309 CDD:409353
Ig strand D 2314..2319 CDD:409353
Ig strand E 2322..2327 CDD:409353
Ig strand F 2336..2342 CDD:409353
Ig strand G 2345..2353 CDD:409353
Ig 2360..2443 CDD:416386
Ig strand A' 2367..2371 CDD:409353
Ig strand B 2375..2381 CDD:409353
Ig strand C 2388..2393 CDD:409353
Ig strand C' 2396..2399 CDD:409353
I-set 9..98 CDD:400151 29/107 (27%)
Ig strand A 9..13 CDD:409353 2/3 (67%)
Ig strand A' 16..21 CDD:409353 3/4 (75%)
Ig strand B 25..33 CDD:409353 3/9 (33%)
Ig strand C 39..44 CDD:409353 3/4 (75%)
Ig strand C' 47..49 CDD:409353 0/10 (0%)
Ig strand D 55..58 CDD:409353 2/2 (100%)
Ig strand E 61..67 CDD:409353 0/7 (0%)
Ig strand F 77..85 CDD:409353 3/7 (43%)
I-set 109..200 CDD:400151 24/102 (24%)
Ig strand A' 115..120 CDD:409353 0/4 (0%)
Ig strand B 126..133 CDD:409353 1/6 (17%)
Ig strand C 139..144 CDD:409353 1/6 (17%)
Ig strand C' 146..148 CDD:409353 0/1 (0%)
Ig strand D 156..159 CDD:409353 0/2 (0%)
Ig strand E 166..172 CDD:409353 3/5 (60%)
Ig strand F 179..186 CDD:409353 2/6 (33%)
I-set 246..326 CDD:400151 75/312 (24%)
Ig strand B 252..259 CDD:409353
Ig strand C 266..272 CDD:409353
Ig strand C' 273..276 CDD:409353
Ig strand D 282..288 CDD:409353
Ig strand E 291..301 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 315..326 CDD:409353
Ig 333..416 CDD:416386
Ig strand A' 335..341 CDD:409353
Ig strand B 348..355 CDD:409353
Ig strand C 360..365 CDD:409353
Ig strand D 375..379 CDD:409353
Ig strand E 384..391 CDD:409353
Ig strand F 398..405 CDD:409353
Ig strand A 422..424 CDD:409353
Ig 423..492 CDD:416386
Ig strand A' 427..431 CDD:409353
Ig strand B 435..441 CDD:409353
Ig strand C 448..453 CDD:409353
Ig strand C' 456..459 CDD:409353
Ig strand D 464..469 CDD:409353
Ig strand E 472..477 CDD:409353
Ig strand F 486..492 CDD:409353
Ig strand G 495..503 CDD:409353
FN3 513..600 CDD:238020
Ig 615..>671 CDD:416386
Ig 710..789 CDD:416386
Ig strand A' 713..717 CDD:409353
Ig strand B 721..727 CDD:409353
Ig strand C 734..739 CDD:409353
Ig strand C' 742..745 CDD:409353
Ig strand D 750..755 CDD:409353
Ig strand E 758..763 CDD:409353
Ig strand F 772..778 CDD:409353
Ig strand G 781..789 CDD:409353
Ig 800..881 CDD:416386
Ig strand A 800..802 CDD:409353
Ig strand A' 805..809 CDD:409353
Ig strand B 813..819 CDD:409353
Ig strand C 826..831 CDD:409353
Ig strand C' 834..837 CDD:409353
Ig strand D 842..847 CDD:409353
Ig strand E 850..855 CDD:409353
Ig strand F 864..870 CDD:409353
Ig strand G 873..881 CDD:409353
Ig 892..973 CDD:416386
Ig strand A 892..894 CDD:409353
Ig strand A' 897..901 CDD:409353
Ig strand B 905..911 CDD:409353
Ig strand C 918..923 CDD:409353
Ig strand C' 926..929 CDD:409353
Ig strand D 934..939 CDD:409353
Ig strand E 942..947 CDD:409353
Ig strand F 956..962 CDD:409353
Ig strand G 965..973 CDD:409353
Ig 984..1065 CDD:416386
Ig strand A 984..986 CDD:409353
Ig strand A' 989..993 CDD:409353
Ig strand B 997..1003 CDD:409353
Ig strand C 1010..1015 CDD:409353
Ig strand C' 1018..1021 CDD:409353
Ig strand D 1026..1031 CDD:409353
Ig strand E 1034..1039 CDD:409353
Ig strand F 1048..1054 CDD:409353
Ig strand G 1057..1065 CDD:409353
Ig 1076..1157 CDD:416386
Ig strand A 1076..1078 CDD:409353
Ig strand A' 1081..1085 CDD:409353
Ig strand B 1089..1095 CDD:409353
Ig strand C 1102..1107 CDD:409353
Ig strand C' 1110..1113 CDD:409353
Ig strand D 1118..1123 CDD:409353
Ig strand E 1126..1131 CDD:409353
Ig strand F 1140..1146 CDD:409353
Ig strand G 1149..1157 CDD:409353
Ig 1168..1249 CDD:416386
Ig strand A 1168..1170 CDD:409353
Ig strand A' 1173..1177 CDD:409353
Ig strand B 1181..1187 CDD:409353
Ig strand C 1194..1199 CDD:409353
Ig strand C' 1202..1205 CDD:409353
Ig strand D 1210..1215 CDD:409353
Ig strand E 1218..1223 CDD:409353
Ig strand F 1232..1238 CDD:409353
Ig strand G 1241..1249 CDD:409353
Ig 1260..1341 CDD:416386
Ig strand A 1260..1262 CDD:409353
Ig strand A' 1265..1269 CDD:409353
Ig strand B 1273..1279 CDD:409353
Ig strand C 1286..1291 CDD:409353
Ig strand C' 1294..1297 CDD:409353
Ig strand D 1302..1307 CDD:409353
Ig strand E 1310..1315 CDD:409353
Ig strand F 1324..1330 CDD:409353
Ig strand G 1333..1341 CDD:409353
Ig 1352..1433 CDD:416386
Ig strand A 1352..1354 CDD:409353
Ig strand A' 1357..1361 CDD:409353
Ig strand B 1365..1371 CDD:409353
Ig strand C 1378..1383 CDD:409353
Ig strand C' 1386..1389 CDD:409353
Ig strand D 1394..1399 CDD:409353
Ig strand E 1402..1407 CDD:409353
Ig strand F 1416..1422 CDD:409353
Ig strand G 1425..1433 CDD:409353
Ig 1444..1525 CDD:416386
Ig strand A 1444..1446 CDD:409353
Ig strand A' 1449..1453 CDD:409353
Ig strand B 1457..1463 CDD:409353
Ig strand C 1470..1475 CDD:409353
Ig strand C' 1478..1481 CDD:409353
Ig strand D 1486..1491 CDD:409353
Ig strand E 1494..1499 CDD:409353
Ig strand F 1508..1514 CDD:409353
Ig strand G 1517..1525 CDD:409353
Ig 1536..1617 CDD:416386
Ig strand A 1536..1538 CDD:409353
Ig strand A' 1541..1545 CDD:409353
Ig strand B 1549..1555 CDD:409353
Ig strand C 1562..1567 CDD:409353
Ig strand C' 1570..1573 CDD:409353
Ig strand D 1578..1583 CDD:409353
Ig strand E 1586..1591 CDD:409353
Ig strand F 1600..1606 CDD:409353
Ig strand G 1609..1617 CDD:409353
Ig 1628..1709 CDD:416386
Ig strand A 1628..1630 CDD:409353
Ig strand A' 1633..1637 CDD:409353
Ig strand B 1641..1647 CDD:409353
Ig strand C 1654..1659 CDD:409353
Ig strand C' 1662..1665 CDD:409353
Ig strand D 1670..1675 CDD:409353
Ig strand E 1678..1683 CDD:409353
Ig strand F 1692..1698 CDD:409353
Ig strand G 1701..1709 CDD:409353
Ig 1720..1801 CDD:416386
Ig strand A 1720..1722 CDD:409353
Ig strand A' 1725..1729 CDD:409353
Ig strand B 1733..1739 CDD:409353
Ig strand C 1746..1751 CDD:409353
Ig strand C' 1754..1757 CDD:409353
Ig strand D 1762..1767 CDD:409353
Ig strand E 1770..1775 CDD:409353
Ig strand F 1784..1790 CDD:409353
Ig strand G 1793..1801 CDD:409353
Ig 1812..1893 CDD:416386
Ig strand A 1812..1814 CDD:409353
Ig strand A' 1817..1821 CDD:409353
Ig strand B 1825..1831 CDD:409353
Ig strand C 1838..1843 CDD:409353
Ig strand C' 1846..1849 CDD:409353
Ig strand D 1854..1859 CDD:409353
Ig strand E 1862..1867 CDD:409353
Ig strand F 1876..1882 CDD:409353
Ig strand G 1885..1893 CDD:409353
Ig 1904..1985 CDD:416386
Ig strand A 1904..1906 CDD:409353
Ig strand A' 1909..1913 CDD:409353
Ig strand B 1917..1923 CDD:409353
Ig strand C 1930..1935 CDD:409353
Ig strand C' 1938..1941 CDD:409353
Ig strand D 1946..1951 CDD:409353
Ig strand E 1954..1959 CDD:409353
Ig strand F 1968..1974 CDD:409353
Ig strand G 1977..1985 CDD:409353
Ig 1996..2077 CDD:416386
Ig strand A 1996..1998 CDD:409353
Ig strand A' 2001..2005 CDD:409353
Ig strand B 2009..2015 CDD:409353
Ig strand C 2022..2027 CDD:409353
Ig strand C' 2030..2033 CDD:409353
Ig strand D 2038..2043 CDD:409353
Ig strand E 2046..2051 CDD:409353
Ig strand F 2060..2066 CDD:409353
Ig strand G 2069..2077 CDD:409353
Ig 2088..2169 CDD:416386
Ig strand A 2088..2090 CDD:409353
Ig strand A' 2093..2097 CDD:409353
Ig strand B 2101..2107 CDD:409353
Ig strand C 2114..2119 CDD:409353
Ig strand D 2404..2409 CDD:409353
Ig strand E 2412..2417 CDD:409353
Ig strand F 2426..2432 CDD:409353
Ig strand G 2435..2443 CDD:409353
Ig 2450..2533 CDD:416386
Ig strand A' 2452..2458 CDD:409353
Ig strand B 2465..2472 CDD:409353
Ig strand C 2477..2482 CDD:409353
Ig strand C' 2484..2487 CDD:409353
Ig strand D 2492..2496 CDD:409353
Ig strand E 2501..2508 CDD:409353
Ig strand F 2515..2523 CDD:409353
Ig 2627..2709 CDD:416386
Ig strand A' 2635..2638 CDD:409353
Ig strand B 2642..2648 CDD:409353
Ig strand C 2654..2659 CDD:409353
Ig strand C' 2662..2665 CDD:409353
Ig strand D 2670..2675 CDD:409353
Ig strand E 2678..2683 CDD:409353
Ig strand F 2692..2698 CDD:409353
Ig strand G 2701..2709 CDD:409353
Ig 2715..2798 CDD:416386
Ig strand B 2731..2735 CDD:409353
Ig strand C 2744..2747 CDD:409353
Ig strand E 2768..2772 CDD:409353
Ig strand F 2782..2787 CDD:409353
Ig 2806..2887 CDD:416386
Ig strand B 2821..2824 CDD:409353
Ig strand C 2832..2836 CDD:409353
Ig strand E 2857..2861 CDD:409353
Ig strand F 2871..2876 CDD:409353
I-set 2983..3066 CDD:400151
Ig strand B 2999..3003 CDD:409353
Ig strand C 3012..3015 CDD:409353
Ig strand E 3036..3040 CDD:409353
Ig strand F 3050..3055 CDD:409353
Ig 3073..3155 CDD:416386
Ig strand A' 3077..3082 CDD:409353
Ig strand B 3088..3094 CDD:409353
Ig strand C 3100..3106 CDD:409353
Ig strand C' 3107..3110 CDD:409353
Ig strand D 3116..3121 CDD:409353
Ig strand E 3124..3134 CDD:409353
Ig strand G 3146..3155 CDD:409353
Ig 3161..3244 CDD:416386
Ig strand B 3177..3181 CDD:409353
Ig strand C 3189..3193 CDD:409353
Ig strand E 3214..3218 CDD:409353
Ig strand F 3228..3233 CDD:409353
Ig 3251..>3319 CDD:416386
Ig strand A' 3255..3260 CDD:409353
Ig strand B 3265..3272 CDD:409353
Ig strand C 3280..3286 CDD:409353
Ig strand C' 3287..3290 CDD:409353
Ig strand D 3295..3301 CDD:409353
Ig strand E 3304..3314 CDD:409353
Ig 3352..3424 CDD:416386
Ig strand B 3356..3362 CDD:409353
Ig strand C 3369..3374 CDD:409353
Ig strand C' 3377..3380 CDD:409353
Ig strand D 3385..3390 CDD:409353
Ig strand E 3393..3398 CDD:409353
Ig strand F 3407..3413 CDD:409353
Ig strand G 3416..3424 CDD:409353
Ig 3430..3513 CDD:416386
Ig strand B 3446..3450 CDD:409353
Ig strand C 3458..3462 CDD:409353
Ig strand E 3483..3487 CDD:409353
Ig 3521..3604 CDD:416386
Ig strand A' 3524..3529 CDD:409353
Ig strand B 3534..3541 CDD:409353
Ig strand C 3548..3554 CDD:409353
Ig strand C' 3555..3558 CDD:409353
Ig strand D 3564..3570 CDD:409353
Ig strand E 3573..3583 CDD:409353
Ig strand G 3593..3604 CDD:409353
I-set 3611..3693 CDD:400151
Ig strand A' 3617..3621 CDD:409353
Ig strand B 3625..3631 CDD:409353
Ig strand C 3638..3643 CDD:409353
Ig strand C' 3646..3649 CDD:409353
Ig strand D 3654..3659 CDD:409353
Ig strand E 3662..3667 CDD:409353
Ig strand F 3676..3682 CDD:409353
Ig strand G 3685..3693 CDD:409353
I-set 3699..3782 CDD:400151
Ig strand A 3701..3704 CDD:409353
Ig strand A' 3706..3709 CDD:409353
Ig strand B 3713..3722 CDD:409353
Ig strand C 3727..3732 CDD:409353
Ig strand C' 3735..3737 CDD:409353
Ig strand D 3743..3748 CDD:409353
Ig strand E 3751..3758 CDD:409353
Ig strand G 3772..3782 CDD:409353
Ig 3788..3870 CDD:416386
Ig strand B 3803..3809 CDD:409353
Ig strand C 3815..3820 CDD:409353
Ig strand C' 3823..3826 CDD:409353
Ig strand D 3831..3836 CDD:409353
Ig strand E 3839..3844 CDD:409353
Ig strand F 3853..3859 CDD:409353
Ig strand G 3862..3870 CDD:409353
Ig 3876..3958 CDD:416386
Ig strand B 3891..3897 CDD:409353
Ig strand C 3903..3908 CDD:409353
Ig strand C' 3911..3914 CDD:409353
Ig strand D 3919..3924 CDD:409353
Ig strand E 3927..3932 CDD:409353
Ig strand F 3941..3947 CDD:409353
Ig strand G 3950..3958 CDD:409353
Ig 3964..4046 CDD:416386
Ig strand B 3979..3985 CDD:409353
Ig strand C 3991..3996 CDD:409353
Ig strand C' 3999..4002 CDD:409353
Ig strand D 4007..4012 CDD:409353
Ig strand E 4015..4020 CDD:409353
Ig strand F 4029..4035 CDD:409353
Ig strand G 4038..4046 CDD:409353
Ig 4052..4134 CDD:416386
Ig strand A' 4055..4061 CDD:409353
Ig strand B 4068..4075 CDD:409353
Ig strand C 4080..4084 CDD:409353
Ig strand C' 4086..4089 CDD:409353
Ig strand D 4094..4098 CDD:409353
Ig strand E 4103..4110 CDD:409353
Ig strand G 4124..4134 CDD:409353
Ig 4140..4222 CDD:416386
Ig strand B 4155..4161 CDD:409353
Ig strand C 4167..4172 CDD:409353
Ig strand C' 4175..4178 CDD:409353
Ig strand D 4183..4188 CDD:409353
Ig strand E 4191..4196 CDD:409353
Ig strand F 4205..4211 CDD:409353
Ig strand G 4214..4222 CDD:409353
Ig 4227..4310 CDD:416386
Ig strand A' 4235..4239 CDD:409353
Ig strand B 4243..4249 CDD:409353
Ig strand C 4255..4260 CDD:409353
Ig strand C' 4263..4266 CDD:409353
Ig strand D 4271..4276 CDD:409353
Ig strand E 4279..4284 CDD:409353
Ig strand F 4293..4299 CDD:409353
Ig strand G 4302..4310 CDD:409353
I-set 4315..4400 CDD:400151
Ig strand A 4315..4317 CDD:409353
Ig strand A' 4319..4325 CDD:409353
Ig strand B 4332..4339 CDD:409353
Ig strand C 4345..4350 CDD:409353
Ig strand D 4360..4364 CDD:409353
Ig strand E 4369..4376 CDD:409353
Ig strand G 4390..4401 CDD:409353
Ig 4405..4488 CDD:416386
Ig strand B 4421..4427 CDD:409353
Ig strand C 4433..4438 CDD:409353
Ig strand C' 4441..4444 CDD:409353
Ig strand D 4449..4454 CDD:409353
Ig strand E 4457..4462 CDD:409353
Ig strand F 4471..4477 CDD:409353
Ig strand G 4480..4488 CDD:409353
Ig 4493..4576 CDD:416386
Ig strand A 4493..4495 CDD:409353
Ig strand A' 4497..4503 CDD:409353
Ig strand B 4510..4517 CDD:409353
Ig strand C 4522..4526 CDD:409353
Ig strand D 4536..4540 CDD:409353
Ig strand E 4545..4552 CDD:409353
Ig strand G 4566..4576 CDD:409353
Ig 4581..4664 CDD:416386
Ig strand B 4597..4603 CDD:409353
Ig strand C 4609..4614 CDD:409353
Ig strand C' 4617..4620 CDD:409353
Ig strand D 4625..4630 CDD:409353
Ig strand E 4633..4638 CDD:409353
Ig strand F 4647..4653 CDD:409353
Ig strand G 4656..4664 CDD:409353
Ig strand A 4668..4671 CDD:409353
Ig 4669..4752 CDD:416386
Ig strand A' 4674..4678 CDD:409353
Ig strand B 4686..4694 CDD:409353
Ig strand C' 4704..4707 CDD:409353
Ig strand D 4713..4718 CDD:409353
Ig strand E 4721..4726 CDD:409353
Ig strand G 4742..4752 CDD:409353
Ig 4757..4840 CDD:416386
Ig strand A' 4765..4769 CDD:409353
Ig strand B 4773..4779 CDD:409353
Ig strand C 4785..4790 CDD:409353
Ig strand C' 4793..4796 CDD:409353
Ig strand D 4801..4806 CDD:409353
Ig strand E 4809..4814 CDD:409353
Ig strand F 4823..4829 CDD:409353
Ig strand G 4832..4840 CDD:409353
Ig 4846..4928 CDD:416386
Ig strand A' 4849..4855 CDD:409353
Ig strand B 4862..4869 CDD:409353
Ig strand C 4874..4878 CDD:409353
Ig strand C' 4880..4883 CDD:409353
Ig strand D 4888..4892 CDD:409353
Ig strand E 4897..4904 CDD:409353
Ig 4934..5017 CDD:416386
Ig strand A 4936..4938 CDD:409353
Ig strand A' 4941..4945 CDD:409353
Ig strand B 4949..4955 CDD:409353
Ig strand C 4962..4967 CDD:409353
Ig strand C' 4970..4973 CDD:409353
Ig strand D 4978..4983 CDD:409353
Ig strand E 4986..4991 CDD:409353
Ig strand F 5000..5006 CDD:409353
Ig strand G 5009..5017 CDD:409353
Ig 5023..5106 CDD:416386
Ig strand B 5038..5044 CDD:409353
Ig strand C 5051..5056 CDD:409353
Ig strand C' 5059..5062 CDD:409353
Ig strand D 5067..5072 CDD:409353
Ig strand E 5075..5080 CDD:409353
Ig strand F 5089..5095 CDD:409353
Ig strand G 5098..5106 CDD:409353
Ig 5123..5197 CDD:416386
Ig strand B 5127..5133 CDD:409353
Ig strand C 5142..5147 CDD:409353
Ig strand C' 5150..5153 CDD:409353
Ig strand D 5158..5163 CDD:409353
Ig strand E 5166..5171 CDD:409353
Ig strand F 5180..5186 CDD:409353
Ig strand G 5189..5197 CDD:409353
Ig 5204..5289 CDD:416386
Ig strand B 5219..5223 CDD:409353
Ig strand C 5232..5236 CDD:409353
Ig strand E 5257..5263 CDD:409353
Ig 5292..5380 CDD:416386
Ig strand A' 5300..5305 CDD:409353
Ig strand B 5310..5317 CDD:409353
Ig strand C 5324..5330 CDD:409353
Ig strand C' 5331..5334 CDD:409353
Ig strand D 5340..5346 CDD:409353
Ig strand E 5349..5359 CDD:409353
Ig strand G 5369..5380 CDD:409353
Ig 5388..5459 CDD:416386
Ig strand A' 5391..5396 CDD:409353
Ig strand B 5401..5408 CDD:409353
Ig strand C 5415..5421 CDD:409353
Ig strand C' 5422..5425 CDD:409353
Ig strand D 5431..5437 CDD:409353
Ig strand E 5440..5450 CDD:409353
Ig_3 5477..5549 CDD:404760
Ig 5566..5651 CDD:416386
Ig 5657..5743 CDD:416386
Ig strand A' 5662..5667 CDD:409353
Ig strand B 5672..5679 CDD:409353
Ig strand C 5687..5693 CDD:409353
Ig strand C' 5694..5697 CDD:409353
Ig strand D 5703..5709 CDD:409353
Ig strand E 5712..5722 CDD:409353
Ig strand F 5726..5734 CDD:409353
FN3 5747..5832 CDD:238020
Ig 5896..5957 CDD:416386
Ig strand B 5902..5908 CDD:409353
Ig strand C 5915..5920 CDD:409353
Ig strand C' 5923..5926 CDD:409353
Ig strand D 5931..5936 CDD:409353
Ig strand E 5939..5944 CDD:409353
I-set 6161..6251 CDD:400151
Ig strand A 6164..6167 CDD:409353
Ig strand A' 6169..6172 CDD:409353
Ig strand B 6176..6185 CDD:409353
Ig strand C 6190..6196 CDD:409353
Ig strand C' 6199..6201 CDD:409353
Ig strand D 6207..6212 CDD:409353
Ig strand E 6215..6223 CDD:409353
Ig strand F 6231..6238 CDD:409353
Ig strand G 6241..6251 CDD:409353
I-set 6391..6481 CDD:400151
Ig strand A 6391..6394 CDD:409353
Ig strand A' 6397..6402 CDD:409353
Ig strand B 6407..6414 CDD:409353
Ig strand C 6421..6427 CDD:409353
Ig strand C' 6428..6431 CDD:409353
Ig strand D 6437..6443 CDD:409353
Ig strand E 6446..6456 CDD:409353
Ig strand F 6460..6468 CDD:409353
Ig strand G 6470..6481 CDD:409353
I-set 6523..6613 CDD:400151
Ig strand A' 6528..6532 CDD:409353
Ig strand B 6540..6549 CDD:409353
Ig strand C 6554..6559 CDD:409353
Ig strand C' 6562..6564 CDD:409353
Ig strand D 6570..6575 CDD:409353
Ig strand E 6578..6583 CDD:409353
Ig strand F 6592..6600 CDD:409353
Ig strand G 6603..6613 CDD:409353
I-set 6634..6729 CDD:400151
Ig strand A 6634..6636 CDD:409353
Ig strand A' 6638..6644 CDD:409353
Ig strand B 6651..6658 CDD:409353
Ig strand C 6664..6669 CDD:409353
Ig strand C' 6671..6674 CDD:409353
Ig strand D 6682..6689 CDD:409353
Ig strand E 6694..6701 CDD:409353
Ig strand F 6708..6716 CDD:409353
SH3_Obscurin_like 6865..6927 CDD:212958
RhoGEF 6960..7136 CDD:413383
PH_Obscurin 7145..7269 CDD:270059
IgI_1_Titin-A168_like 7277..7367 CDD:409563
Ig strand B 7294..7298 CDD:409563
Ig strand C 7307..7311 CDD:409563
Ig strand E 7334..7338 CDD:409563
Ig strand F 7347..7352 CDD:409563
Ig strand G 7360..7363 CDD:409563
Ig_3 7370..7449 CDD:404760
Ig strand A 7370..7373 CDD:409353
Ig strand A' 7376..7380 CDD:409353
Ig strand B 7388..7396 CDD:409353
Ig strand C 7401..7406 CDD:409353
Ig strand C' 7409..7411 CDD:409353
Ig strand D 7417..7422 CDD:409353
Ig strand E 7427..7432 CDD:409353
Ig strand F 7441..7449 CDD:409353
Ig strand G 7452..7462 CDD:409353
I-set 7625..7714 CDD:400151
Ig strand B 7641..7648 CDD:409353
Ig strand C 7655..7661 CDD:409353
Ig strand C' 7662..7665 CDD:409353
Ig strand E 7678..7689 CDD:409353
Ig strand F 7693..7701 CDD:409353
Ig strand G 7703..7714 CDD:409353
PKc_like 7732..7988 CDD:419665
I-set 8705..8787 CDD:400151
Ig strand B 8722..8726 CDD:409353
Ig strand C 8735..8739 CDD:409353
Ig strand E 8760..8765 CDD:409353
Ig strand F 8775..8780 CDD:409353
Ig strand G 8789..8792 CDD:409353
FN3 8799..8877 CDD:214495
PKc_like 8911..9167 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.