DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr9 and havcr2

DIOPT Version :10

Sequence 1:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_003200921.2 Gene:havcr2 / 100536120 ZFINID:ZDB-GENE-091204-20 Length:231 Species:Danio rerio


Alignment Length:123 Identity:33/123 - (26%)
Similarity:50/123 - (40%) Gaps:21/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIH-----LLTVG--RYTYTSDQRFRAIH 320
            ||.|..|:|.|..|.|:...  |....|.|.|.||:.:.     ::::.  :..|....||....
Zfish    21 SKLVIGLVGDTVTLPCKYDI--NTNGPLGVCWGRHQSLFSCENTVISIDGLQLNYRESHRFSLDS 83

  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESG 378
            .....|..|.|:..|..|:|:|.|::. .|.:.:.|..||.           |:|.||
Zfish    84 GLDRGDVSLTIRAVQKSDAGMYVCRIE-IPGLFNDISYNVY-----------LFIRSG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr9NP_996215.1 IG_like 263..360 CDD:214653 27/103 (26%)
Ig strand B 274..278 CDD:409355 1/3 (33%)
Ig strand C 291..295 CDD:409355 1/3 (33%)
Ig strand E 327..331 CDD:409355 1/3 (33%)
Ig strand F 341..346 CDD:409355 2/4 (50%)
IG_like 371..464 CDD:214653 4/8 (50%)
Ig strand B 381..385 CDD:143220
Ig strand C 396..400 CDD:143220
Ig strand E 431..437 CDD:143220
Ig strand F 447..452 CDD:143220
havcr2XP_003200921.2 Ig 24..126 CDD:472250 28/115 (24%)
Ig strand B 32..36 CDD:409574 1/3 (33%)
Ig strand C 47..51 CDD:409574 1/3 (33%)
Ig strand E 90..94 CDD:409574 1/3 (33%)
Ig strand F 104..109 CDD:409574 2/4 (50%)
Ig strand G 119..122 CDD:409574 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.