DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr9 and havcr2

DIOPT Version :9

Sequence 1:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_003200921.2 Gene:havcr2 / 100536120 ZFINID:ZDB-GENE-091204-20 Length:231 Species:Danio rerio


Alignment Length:123 Identity:33/123 - (26%)
Similarity:50/123 - (40%) Gaps:21/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIH-----LLTVG--RYTYTSDQRFRAIH 320
            ||.|..|:|.|..|.|:...  |....|.|.|.||:.:.     ::::.  :..|....||....
Zfish    21 SKLVIGLVGDTVTLPCKYDI--NTNGPLGVCWGRHQSLFSCENTVISIDGLQLNYRESHRFSLDS 83

  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESG 378
            .....|..|.|:..|..|:|:|.|::. .|.:.:.|..||.           |:|.||
Zfish    84 GLDRGDVSLTIRAVQKSDAGMYVCRIE-IPGLFNDISYNVY-----------LFIRSG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr9NP_001287332.1 Ig 263..361 CDD:299845 28/104 (27%)
IG_like 263..360 CDD:214653 27/103 (26%)
IG_like 371..464 CDD:214653 4/8 (50%)
IGc2 377..456 CDD:197706 2/2 (100%)
havcr2XP_003200921.2 V-set 19..109 CDD:284989 25/89 (28%)
IG_like 21..110 CDD:214653 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.