DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33331 and Tamm41

DIOPT Version :9

Sequence 1:NP_996213.1 Gene:CG33331 / 2768668 FlyBaseID:FBgn0067628 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_081170.1 Gene:Tamm41 / 68971 MGIID:1916221 Length:337 Species:Mus musculus


Alignment Length:337 Identity:141/337 - (41%)
Similarity:190/337 - (56%) Gaps:27/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRTVARFPLGSVSYMFAYGSGVKQQEGYGKVGNGNNLRPPPGTVVDLVFCVRDARGFHAENLHRH 70
            ||.:|.|| ..:|..|||||.|.:|.|    .:.:...|    ::||||.|.|...:||.||.::
Mouse    14 RRILAHFP-EDLSLAFAYGSAVYRQAG----PSAHQENP----MLDLVFTVDDPVAWHAMNLKKN 69

  Fly    71 PDHYSALRHLGPNFVAKYQERLGAGVYCNTLVPLPDVGITIKYGVVSQEELLEDLLDWRHLYLAG 135
            ..|||.|:.|||..::..|...|||||.|.|:...  |..|||||:|...|:||||:|.:||:||
Mouse    70 WSHYSFLKLLGPRIISSIQNNYGAGVYFNPLIRCD--GKLIKYGVISTGTLIEDLLNWNNLYIAG 132

  Fly   136 RLHKPVTNLVNPSDNPPLKAALERNLVSALQVALLLLPEKFTAYGLFHTIAGLSYKGDFRMIFGE 200
            ||.||| .:|:.::|..|:|||::||.||:..|.|:|||.|:...||..||||||.|||||:.||
Mouse   133 RLQKPV-KIVSMNENMALRAALDKNLRSAVTTACLMLPESFSEEDLFIEIAGLSYSGDFRMVIGE 196

  Fly   201 NKQKVHNIVSPQINDFFALYQPSLGQLSDYVAVNM-KGQEPGSRKPAIIFEQDKSSSATCQHLRQ 264
            .|.||.|||.|.:..|..||: |:.|....|...| :||          .|.|||.......|..
Mouse   197 EKSKVLNIVKPNVGHFRELYE-SILQKDPQVVYKMHQGQ----------LEIDKSPEGQFTQLMT 250

  Fly   265 LPRELQKRLQRNAACRGDYTQVVNHLSMASQLP---EVLQASVNDIVWRSSVTQSIKNIPSAGIL 326
            |||.||:::.......|....|...|...:|.|   :|::.:::.||..||:.||.|.:.:||:.
Mouse   251 LPRTLQQQINHIMDPPGRNRDVEETLLQVAQDPDCGDVVRLAISSIVRPSSIRQSTKGLFTAGMK 315

  Fly   327 KSLAYSYRKAQK 338
            ||:.||.||..|
Mouse   316 KSVIYSSRKLNK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33331NP_996213.1 Mmp37 5..338 CDD:286252 140/335 (42%)
Tamm41NP_081170.1 Mmp37 13..327 CDD:286252 140/335 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850624
Domainoid 1 1.000 210 1.000 Domainoid score I2818
eggNOG 1 0.900 - - E1_KOG2986
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13754
Inparanoid 1 1.050 210 1.000 Inparanoid score I3655
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57884
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005617
OrthoInspector 1 1.000 - - oto95050
orthoMCL 1 0.900 - - OOG6_103248
Panther 1 1.100 - - LDO PTHR13619
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1478
SonicParanoid 1 1.000 - - X4021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.