DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG34409

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:357 Identity:99/357 - (27%)
Similarity:160/357 - (44%) Gaps:71/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QPVP-SVPITFAPPV-------PTITSSPAPAPPPPP-------PLPTPPAVVTVPPATPPPQRF 256
            :||| ..||.|...:       ..|.|:....||..|       |:.|.||.::...|:.|    
  Fly   172 RPVPKDKPIVFPGDLRFQRQGEEAIDSNIDQGPPLAPFTTTLATPIETIPASLSTTTASMP---- 232

  Fly   257 DPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRA--LAFKCRGSLISSSIVISA 319
             |.:|.::..||....:.  ::.|::...||:|||:.:.::...:  ::|:|.||||||:.:::|
  Fly   233 -PFAQENTQGCGINVESR--LLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTA 294

  Fly   320 AHCVHRMTEDRVV--VGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVT 382
            ||||..:..|..:  |.||       .:|||....:.:::.||:|:...|:: ||||:.|.   :
  Fly   295 AHCVVNLVSDLELSHVRLG-------SQDGATPFAIEQVIVHPNYDQPKYAN-DIALLRIN---S 348

  Fly   383 FNDIIAPICM-----WTVEASRTVSTTGFIAGW--GRDED------SSRTQYPRVVEAEIASPTV 434
            .|....|||:     .|: .:|.:...|..|||  |..|:      |:.|...|.:...|.:.|.
  Fly   349 TNGTFTPICLPFNGPITL-GNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTS 412

  Fly   435 CASTW--------RGTMVTERSLCAGNRDGSGPCVGDSGG--------GLMVKQGDRWLLRGIVS 483
            ||..:        :..::|...|||.....:..|.|||||        |:....| |:.:.|||:
  Fly   413 CAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSG-RYTIIGIVA 476

  Fly   484 AGERGPAGTCQLNQYVLYCDLSKHINWISENI 515
            .|......|.....|.|   :|...:||..:|
  Fly   477 FGPTLCGVTTIPGVYTL---VSSFSDWILRSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 77/269 (29%)
Tryp_SPc 277..511 CDD:214473 75/266 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 75/269 (28%)
Tryp_SPc 252..501 CDD:238113 75/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.