DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG34436

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:112/247 - (45%) Gaps:61/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 PWLSAVYHKEVRALAFK-CRGSLISSSIVISAAHCVHRMTEDRVVVGLGR----------YDLDD 342
            ||::.|      .|..| |.|:||....||::|.||  ..::|.:|.||:          |..||
  Fly    42 PWMALV------LLPNKTCSGALIHKYFVITSASCV--FNQERAIVRLGQLSIKQEHIVSYSSDD 98

  Fly   343 YGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF- 406
            |        :|.....|..|. :|..:.||||:.::..|.:...|.|||:|..::.  :.|..| 
  Fly    99 Y--------HVQSAYIHRFYE-KSNFEHDIALLELQNDVLYKAHIRPICLWLDKSD--IDTQMFK 152

  Fly   407 ---IAGWGRDEDSSRTQY--PRVVEAEI--ASPTVCASTWRGTMVTERS-LCAGNRDGSGPCVGD 463
               ...||.||     :|  |....::|  .|...|.:.::  :..:.| :|||.::.| .|| :
  Fly   153 RYETFRWGIDE-----KYILPAAKTSKIKHISQVKCENAFK--LYPQNSHICAGYKNKS-KCV-E 208

  Fly   464 SGGGLMVK----QGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511
            :|..|..|    ...|:.|.||.|.||   :.||      ||.|::|:|:||
  Fly   209 TGSPLFKKIRYYTKIRYTLFGIQSYGE---SRTC------LYTDVTKYIDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 73/247 (30%)
Tryp_SPc 277..511 CDD:214473 71/245 (29%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 73/247 (30%)
Tryp_SPc 40..251 CDD:214473 71/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.