DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG34171

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:94/235 - (40%) Gaps:52/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CRGSLISSSIVISAAHCVH-----RMTEDRVVVGL--GRYDLDDYGEDGAEMRNVMRLLWHPDYN 363
            |.|.::::..|:::|||:.     .|:..|:||.|  ..:...:..|...::.|   ::.||.|:
  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHN---MIIHPYYH 118

  Fly   364 TRSYSDADIALITIERPVTFN-DIIAPICMW--TVEASRTVSTTGFIAGWGRDEDSSRTQYPRVV 425
            ...::  |||:|.::|.|..: ..:||:.:.  ::|......|.|.|.|..|....| .....:|
  Fly   119 RNQHN--DIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGS-FHSMLLV 180

  Fly   426 EAEIASPTVCASTWRGTMV-------------TERSLCAGNRDGSGP--CVGDSGGGLMVKQGDR 475
            ..|:.....|....:..|.             ||:.:|  ..|..||  |.|...|         
  Fly   181 NVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMC--TTDFGGPLFCDGQLYG--------- 234

  Fly   476 WLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENI 515
             :..|.::.....|         |.:.|:|.:.:|:::.|
  Fly   235 -IALGSINCSSPDP---------VFFSDVSFYNSWVTKII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 50/232 (22%)
Tryp_SPc 277..511 CDD:214473 49/229 (21%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 49/229 (21%)
Tryp_SPc 38..263 CDD:304450 50/232 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.