DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:327 Identity:80/327 - (24%)
Similarity:129/327 - (39%) Gaps:97/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ITFAPPVPTITSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIV 278
            :..|..|...|:.||||                ...||.|.: |.:.:|::.....||. .|:||
  Fly     5 VFLALAVAAATAVPAPA----------------QKLTPTPIK-DIQGRITNGYPAYEGK-VPYIV 51

  Fly   279 ----RGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYD 339
                .||    |.: |               |.||:|.::.|::||||.:..:...:        
  Fly    52 GLLFSGN----GNW-W---------------CGGSIIGNTWVLTAAHCTNGASGVTI-------- 88

  Fly   340 LDDYGEDGAEMRNVMR---------LLWHPDYNTRSYSDADIALI------------TIERPVTF 383
              :|   ||.:|...:         ::.|..||:.:..: ||:||            .:|.| ::
  Fly    89 --NY---GASIRTQPQYTHWVGSGDIIQHHHYNSGNLHN-DISLIRTPHVDFWSLVNKVELP-SY 146

  Fly   384 NDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIASPTVCASTWRGTMVTER 447
            ||.......|...||          |||...|.| ...:.:.|:.:|.|.:.|:.||   .:.:.
  Fly   147 NDRYQDYAGWWAVAS----------GWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW---SLHDN 198

  Fly   448 SLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWIS 512
            .:|.....|...|.|||||.|:...|:|  |.|:.|.|.   |..||.....::..::.:::||.
  Fly   199 MICINTDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGS---AAGCQSGAPAVFSRVTGYLDWIR 258

  Fly   513 EN 514
            :|
  Fly   259 DN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 64/262 (24%)
Tryp_SPc 277..511 CDD:214473 62/259 (24%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 68/277 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.