DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG11843

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:119/293 - (40%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PRSQISSVVCGREGSTTPFIVRGN-----EFPR----GQYPWLSAVYHKEVRALAFKCRGSLISS 313
            |.:.|.|.:.....|.||.||.|:     |||.    |:.|..|:      ||..| |.|.|||.
  Fly    49 PGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSS------RADWF-CGGVLISE 106

  Fly   314 SIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVM--RLLWHPDYNTRSYSDADIALIT 376
            ..|::||||:.....:..||.||..|.|...||.|. |:.|  ..:.||.|....:.. ||.|:.
  Fly   107 RFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAP-RDYMVAGYIAHPGYEDPQFYH-DIGLVK 169

  Fly   377 IERPVTFNDIIAPICMWTVEASRTVSTTGFIA-GWGRDEDSSRTQYPRV----VEAEIASPTVCA 436
            :...|.|:....|.|: ..:..|  |:..||| |||   .:.....|..    |:.:.....||.
  Fly   170 LTEAVVFDLYKHPACL-PFQDER--SSDSFIAVGWG---STGLALKPSAQLLKVKLQRYGNWVCK 228

  Fly   437 STWRGTMVTER------------SLCAGNRDGSGPCVGDSGGGLMVKQGD---RWLLRGIVSA-- 484
            .     ::|.:            .||.|:......|.|||||.|::...:   .:::.||.||  
  Fly   229 K-----LLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL 288

  Fly   485 --GERGPAGTCQLNQYVLYCDLSKHINWISENI 515
              |..|..|        :|..:..::.||:..:
  Fly   289 SCGSPGIPG--------IYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 76/271 (28%)
Tryp_SPc 277..511 CDD:214473 74/268 (28%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 76/271 (28%)
Tryp_SPc 68..309 CDD:214473 74/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.