DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG31219

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:301 Identity:86/301 - (28%)
Similarity:136/301 - (45%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFK--CRGSLISS 313
            |||....|    |:.:||:..||.. :|.|:|.....|||::.:.:.....|...  |.||||::
  Fly    68 PPPGNRLP----STEICGQSLSTYR-MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINN 127

  Fly   314 SIVISAAHCVHRMTEDRVV--VGLGRYDL---DDYGEDGAEMRN----------VMRLLWHPDYN 363
            ..|:::||||:.:..|..:  |.||.:|:   ..|..|..:..|          :.:::.|..::
  Fly   128 RYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFS 192

  Fly   364 TRSYS--DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF-------IAGWGRDEDSSRT 419
            :.|..  :.||||:.::.||.:...|.|||         :...||       |||||:..:.   
  Fly   193 SISNRNIEYDIALLRLKMPVRYRTGIMPIC---------IPKHGFFAKSKLEIAGWGKTNEG--- 245

  Fly   420 QYPRVV------EAEIASPTVCASTWRGTMVTER-SLCAGNRDGSGPCVGDSGGGLMVKQGDRWL 477
            |:.:|:      |..||   |||..:....:.:. .:|||..||...|.|||||.|||...:..:
  Fly   246 QFSQVLMHGFIRERSIA---VCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV 307

  Fly   478 -LRGIVSAGERGPAGTC-QLNQYVLYCDLSKHINWISENIR 516
             |.||.:.|.:    .| |:....:|...|..:.||...:|
  Fly   308 YLAGITTYGSK----NCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 76/271 (28%)
Tryp_SPc 277..511 CDD:214473 74/268 (28%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 74/270 (27%)
Tryp_SPc 90..342 CDD:238113 76/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.