DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG5255

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:203 Identity:56/203 - (27%)
Similarity:88/203 - (43%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCV--HRMTEDRVVVGLGRYD 339
            ||.|.|...|..|:..::  :.:.:.|..|.|::|....:|:||||.  .:.|..||:.|     
  Fly    30 IVGGEEAAAGLAPYQISL--QGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTG----- 87

  Fly   340 LDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTT 404
            ..|..::|::.....|::.|.:|..|.|.: ||||:.:...:.|::...|     ||........
  Fly    88 TQDLHQNGSKYYYPDRIVEHSNYAPRKYRN-DIALLHLNESIVFDNATQP-----VELDHEALVP 146

  Fly   405 G---FIAGWGR----DEDSSRTQYPRVVEAEIASPTVC-ASTWRGTMVTERSLCAGNRDGSGPCV 461
            |   .:.|||.    .:..:|.|   .:|........| |:....|.|....:|..|..|.|.|.
  Fly   147 GSRLLLTGWGTLSLGGDVPARLQ---SLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACH 208

  Fly   462 GDSGGGLM 469
            |||||.|:
  Fly   209 GDSGGPLV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 56/203 (28%)
Tryp_SPc 277..511 CDD:214473 56/203 (28%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 56/203 (28%)
Tryp_SPc 30..252 CDD:238113 56/203 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.