DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG8870

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:285 Identity:78/285 - (27%)
Similarity:115/285 - (40%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CG--REGSTTPFIVRGNEFPRGQYPWLSAVYHKE----VRALAFKCRGSLISSSIVISAAHCVH- 324
            ||  |...|...|...|||     ||::.:.:..    .:.|..||.||||::..|::|||||. 
  Fly    77 CGQSRRKPTKGKIPALNEF-----PWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY 136

  Fly   325 ------------RMTE-------DRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDA 370
                        |:.|       ||.:|...|.....|.|     ..|.:::.|..:|.......
  Fly   137 PFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYME-----IEVDQIITHEQFNRGRRLIN 196

  Fly   371 DIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGW---GRDEDSSRTQYPRVVEAEIASP 432
            ||||:.::.||.:...|.|||:...:...........:||   |:...|.......:.|..   |
  Fly   197 DIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERH---P 258

  Fly   433 TVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLM--VKQGDRWL--LRGIVSAGERGPAGTC 493
            .||.|.:...:.::  :|||..||:....|||||.||  |.:|...|  ..||:|.|::    .|
  Fly   259 DVCKSNYDFNLGSQ--ICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQK----PC 317

  Fly   494 QLN--QYVLYCDLSKHINWISENIR 516
            .|.  :...|...|....||...::
  Fly   318 VLKTCKPAFYTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 74/269 (28%)
Tryp_SPc 277..511 CDD:214473 72/266 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 73/265 (28%)
Tryp_SPc 93..337 CDD:214473 71/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.