DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG11670

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:410 Identity:106/410 - (25%)
Similarity:161/410 - (39%) Gaps:101/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 FTQPWTTVSNRSPAVVTPAPTPTEIFWNQ-------------------------PVPSVPITFAP 218
            :.:|:   .|.:|   .|.|.||...:|.                         |.||.|....|
  Fly    33 YPEPY---RNPNP---NPVPDPTRWDFNNYNSYGYNGQWAPGYFNNYGYYRPPPPPPSPPCGRPP 91

  Fly   219 PVPTITSSPAPAPPPPPPLPTPPAVVTVP--------------PATPPPQR--------FDPRSQ 261
            |     .||.|.||||.|.|..|.....|              |..|||..        .:..|:
  Fly    92 P-----GSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQWQPRRPPPNHHRNFHNIFLNTESK 151

  Fly   262 ISSVVCGREGST----TPFIVRGNEFPRGQYPWLSAV-YHKEVRALAFKCRGSLISSSIVISAAH 321
            :......:...|    ..|..|....| ||||.::|: :..|...:.:||.|||||...|::|||
  Fly   152 VDGENYNKTAETEDLHDDFNGRSIVAP-GQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAH 215

  Fly   322 CV--HRMTEDRVVVG---LGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPV 381
            |:  |..:.|.|.:|   |..::|:    ...:.|.|.::..||.||. |.:..||.||.:.|||
  Fly   216 CLTTHGTSPDIVKIGDIKLKEWELN----VAPQRRRVAQIYLHPLYNA-SLNYHDIGLIQLNRPV 275

  Fly   382 TFNDIIAPICMWTVE--ASRTVSTTGF-IAGWGRDEDSSRTQYP-RVVEAEIASPTVCASTWRGT 442
            .:...:.|:.:|.:.  ....:.|.|: ..|:.:.:.:..|:.. .||..|..:.::.|......
  Fly   276 EYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPH 340

  Fly   443 MVTERSLCA----GNRDGSGPCVGDSGGGLMV-----------KQGDRWLLRGIVSAGERGPAGT 492
            .:....:||    .|||   .|.|||||.|.:           ::..|:.|.||.|.|     ..
  Fly   341 GLLTSQICAHDYEKNRD---TCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYG-----AY 397

  Fly   493 CQLNQYVLYCDLSKHINWIS 512
            |:.....:|..:|.:|:||:
  Fly   398 CRSELPGVYTRVSSYIDWIA 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 74/261 (28%)
Tryp_SPc 277..511 CDD:214473 72/258 (28%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47719
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.