DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG11668

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:413 Identity:82/413 - (19%)
Similarity:143/413 - (34%) Gaps:122/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PWTTVSNRSPAVVTPAPTPTEIFWNQPVPSVP-----------ITFAPPVPTITSSPAPAP---- 231
            ||..|:        |:....:|:.|......|           |:....||.:|....|:.    
  Fly    27 PWNAVA--------PSYLSIDIYGNCQAHDRPLIGKCVRYVDCISAMQAVPRVTPLLCPSSWPNQ 83

  Fly   232 -----------PPPPPLPTPPAVVTVPPATPPPQRFDPRS------QISSV--VCGREGSTTPFI 277
                       |||....:..|.....|.....:|...|:      |:..|  :..:...:...:
  Fly    84 LVCCPHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLL 148

  Fly   278 VRGNEFPRGQYPWLSAV------------YHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDR 330
            |.|......::|::.|:            :....|...|.|..::|:....|:||||.....|..
  Fly   149 VGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESP 213

  Fly   331 VVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIER----PVTFNDIIAPIC 391
            .|..:|..:|:   ....::..:.|:..||.::..:.:: |:|::.:.|    ||.        |
  Fly   214 SVALIGGVELN---SGRGQLIEIKRISQHPHFDAETLTN-DLAVVKLARRSHMPVA--------C 266

  Fly   392 MWTVEA--SRTVSTTGF----IAGWGRDEDSSRTQ-----------------YPRVVEAEIASPT 433
            :|..|:  .|.::..|:    .||   ...|:..|                 |.::... :.|..
  Fly   267 LWNQESLPERPLTALGYGQTKFAG---PHSSNLLQIMLYHLNFQQCQRYLHNYDKLANG-LGSGQ 327

  Fly   434 VCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRW------LLRGIVSAGERGPAGT 492
            :||..:.|.|.|              |.|||||.|::.|..|.      .:.||.|.|     |.
  Fly   328 MCAGDYSGNMDT--------------CQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG-----GA 373

  Fly   493 CQLNQYVLYCDLSKHINWISENI 515
            |...|..:|..::.:|.||.:.:
  Fly   374 CASGQPGVYVRIAHYIQWIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 61/281 (22%)
Tryp_SPc 277..511 CDD:214473 59/278 (21%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 61/280 (22%)
Tryp_SPc 149..392 CDD:214473 59/277 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.