DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG13318

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:354 Identity:89/354 - (25%)
Similarity:147/354 - (41%) Gaps:65/354 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 PVPSVPITFAPPVPTITS---SPAPAPPP---PPPLPTPPA---------VV------TVPPATP 251
            |....|.|: ||||:|.|   |.....||   ..||||.|:         :|      |||..:.
  Fly    69 PPQVAPGTW-PPVPSIVSPGTSYCQCVPPGSCANPLPTAPSDGSGQIDIRIVNNGGYPTVPTTSS 132

  Fly   252 P---PQRFDPRSQISSVVCGRE-----GSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRG 308
            .   ........|..|..|||.     ||||   ....:...|.|||.:|:.   ..|..:...|
  Fly   133 TLTCSYGLVACCQAGSYQCGRRFPPPPGSTT---AAPGQASFGAYPWQAALL---TTADVYLGGG 191

  Fly   309 SLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGED-GAEMRNVMRLLWHPDYNTRSYSDADI 372
            :||::..|::|||.|:.:......|.||.:|.....|. .|:...:..:..:|.:|..:..: |:
  Fly   192 ALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQN-DV 255

  Fly   373 ALITIERPV--TFNDIIAPICMWTVEASRTVSTTG---FIAGWGRDEDSSRTQYPRVVEAEIASP 432
            |::.:..||  |....:..:|:      .|.|..|   ::||||:::..:...| :.:|.::..|
  Fly   256 AILKLSTPVSLTSKSTVGTVCL------PTTSFVGQRCWVAGWGKNDFGATGAY-QAIERQVDVP 313

  Fly   433 TV----CASTWRGT------MVTERS-LCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGE 486
            .:    |.:..:.|      :::..| :|||...|...|.||.|..|:......|.:.|:|:.| 
  Fly   314 LIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWG- 377

  Fly   487 RGPAGTCQLNQYVLYCDLSKHINWISENI 515
               .|..|.....:|.::..::.||...:
  Fly   378 ---IGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 59/253 (23%)
Tryp_SPc 277..511 CDD:214473 57/250 (23%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 59/247 (24%)
Tryp_SPc 169..399 CDD:214473 57/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.