DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG14642

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:397 Identity:107/397 - (26%)
Similarity:157/397 - (39%) Gaps:103/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GFTQPWTTVSNRSPA---VVTP----AP-TPTEIFW---------NQPVPSVPITFAPPVPTITS 225
            |..:|....|.|||.   :|.|    .| .|.|..|         ....|:.|            
  Fly    30 GRMRPLQDDSIRSPVDRDIVFPELDAGPGKPEEKMWFHITDFQFDRVEGPTQP------------ 82

  Fly   226 SPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVR----------- 279
            .|.|...||||:|.       .|..|||..|..:......:|  |...:.::.|           
  Fly    83 KPKPRQYPPPPMPG-------QPFPPPPGGFKKKENKQRRLC--EQKYSEYVERIFPNDTAVAAD 138

  Fly   280 -------GNEFPR-GQYPWLSAV-YHKEVRALAFKCRGSLISSSIVISAAHC--VHRMTEDRVVV 333
                   |....| |:||.::|| :..:...:.:||.|||||...|::||||  ::......|.:
  Fly   139 ANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI 203

  Fly   334 GLGRYDLDDYGED---GAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTV 395
            |    |||...|.   .|::..:.::..||:|..:.|.| ||||:.:|:.|...:.:.|:.:|..
  Fly   204 G----DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD-DIALLKLEKEVELTEYVRPVRLWVF 263

  Fly   396 EASRTVSTTGFIAGWG----------RDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLC 450
            ....|  |..|..|:|          |..:.:.|..|. .|.....|.: |.|..|  |.|..:|
  Fly   264 PELPT--TIAFAMGYGATSFAKPMTNRLTNLNLTVVPN-AECNAELPPL-AETPSG--VLESQIC 322

  Fly   451 AG----NRDGSGPCVGDSGGGLMV-----KQGDR--WLLRGIVSAGERGPAGTCQLNQYVLYCDL 504
            |.    |||   .|.|||||.|.:     ::|.|  :.|.||.|.|.     .|:.:...:|..:
  Fly   323 AQDYILNRD---TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV-----FCRSSYPSVYTRV 379

  Fly   505 SKHINWI 511
            |..::||
  Fly   380 SSFLDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 79/281 (28%)
Tryp_SPc 277..511 CDD:214473 77/279 (28%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/260 (30%)
Tryp_SPc 146..386 CDD:214473 76/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.