DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Sems

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:196 Identity:52/196 - (26%)
Similarity:86/196 - (43%) Gaps:36/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 FKCRGSLISSSIVISAAHCVHRMTEDR-------VVVGLGRYDLDDYGEDGAEMRNVMRLLWHPD 361
            |.|.|:||...||::||||.    |||       |..|:.|     ..|.|.. |.|.|.:....
  Fly    68 FICGGTLIHELIVLTAAHCF----EDRAEKEAWSVDGGISR-----LSEKGIR-RQVKRFIKSAQ 122

  Fly   362 YNTRSYSDADIALITIERPVTFNDI-IAPICMWTVEASRTVSTTGFIAGWG--RDEDSSRTQYPR 423
            :...: .:.|:|::.:.||:...:| ...:|...:...:|:.    ::|||  ..:|.......|
  Fly   123 FKMVT-MNMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMD----VSGWGMTNPDDEGPGHMLR 182

  Fly   424 VVEAEIASPTVCASTWRGTM-VTERSLCA---GNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSA 484
            .|...:....:|...:|.:: :::...||   |.:|.   |..||||.|:.::    .:.||||.
  Fly   183 TVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDA---CTYDSGGPLVYEK----QVCGIVSF 240

  Fly   485 G 485
            |
  Fly   241 G 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 52/196 (27%)
Tryp_SPc 277..511 CDD:214473 52/196 (27%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 52/196 (27%)
Tryp_SPc 44..265 CDD:238113 52/196 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.