Sequence 1: | NP_996209.2 | Gene: | Sp212 / 2768666 | FlyBaseID: | FBgn0053329 | Length: | 516 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649270.1 | Gene: | Sems / 40315 | FlyBaseID: | FBgn0037036 | Length: | 275 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 86/196 - (43%) | Gaps: | 36/196 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 FKCRGSLISSSIVISAAHCVHRMTEDR-------VVVGLGRYDLDDYGEDGAEMRNVMRLLWHPD 361
Fly 362 YNTRSYSDADIALITIERPVTFNDI-IAPICMWTVEASRTVSTTGFIAGWG--RDEDSSRTQYPR 423
Fly 424 VVEAEIASPTVCASTWRGTM-VTERSLCA---GNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSA 484
Fly 485 G 485 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sp212 | NP_996209.2 | GD_N | 23..122 | CDD:292649 | |
Tryp_SPc | 277..514 | CDD:238113 | 52/196 (27%) | ||
Tryp_SPc | 277..511 | CDD:214473 | 52/196 (27%) | ||
Sems | NP_649270.1 | Tryp_SPc | 43..263 | CDD:214473 | 52/196 (27%) |
Tryp_SPc | 44..265 | CDD:238113 | 52/196 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 74 | 1.000 | Inparanoid score | I3868 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |