DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG7542

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:123/258 - (47%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PFIVRGNEFPRGQYPWLSAVYHKEVRALAFK-----CRGSLISSSIVISAAHCVHRMTEDRVVVG 334
            |:|..|.....||:|:.:.:      .::|.     |.|:|||...:|:||||:.  ..:.|.|.
  Fly    25 PYITNGEPAEVGQFPYQAGL------NVSFGNWSTWCGGTLISHYWIITAAHCMD--GAESVTVY 81

  Fly   335 LGRYDLDDYGEDGAEMRNVMR--LLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICM----- 392
            ||..::.|..|:|.|...|.:  ::.|.:|...:..: ||:||.:...|.|.|.|....:     
  Fly    82 LGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN-DISLIRLPAFVGFTDRIRAASLPRRLN 145

  Fly   393 ---WTVEASRTVSTTGFIAGWGRDEDSSRTQYP--RVVEAEIASPTVCASTWRGTMVTERSLCAG 452
               .|.|:.|     .|.:||||:.|:|.:..|  |.||..|...::|...|.|. |:|:.:|..
  Fly   146 GQFPTYESIR-----AFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGA-VSEKMICMS 204

  Fly   453 NRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENI 515
            ...|...|.|||||.|:.|||:...|.|..|.   |.:..||:....::..:|.:::||..:|
  Fly   205 TTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSF---GTSMGCQVGFPAVFTRISSYLDWILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 76/253 (30%)
Tryp_SPc 277..511 CDD:214473 74/250 (30%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 76/253 (30%)
Tryp_SPc 27..260 CDD:214473 74/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.