DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG4914

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:361 Identity:98/361 - (27%)
Similarity:144/361 - (39%) Gaps:83/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TITSSPAPAPPPPPPLPTPPAVVT-------VP--------------------------PATPPP 253
            |..:|..||.|..|....|||..|       :|                          .|..|.
  Fly    22 TAATSATPATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSSDANKPV 86

  Fly   254 QRFDP----------------RSQIS---SVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEV 299
            .|.:|                ::|.|   |..|| |.:....||.|......:|||::.:.:.. 
  Fly    87 FRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCG-ERNDESRIVGGTTTGVSEYPWMARLSYFN- 149

  Fly   300 RALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYD-LDDYGEDGAEMRNVMRLLWHPDYN 363
               .|.|.|:||:...|::|||||.......:.|..|.:| .:|  ::..|.|.|:|..      
  Fly   150 ---RFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCND--KERPETRFVLRAF------ 203

  Fly   364 TRSYS----DADIALITIERPVTFNDIIAPICMWTVEASRT--VSTTGFIAGWGR-DEDSSRTQY 421
            ::.:|    |.||||:.:...|.....|.|||:..||..:.  |.|.....|||. .||...:..
  Fly   204 SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCL 268

  Fly   422 PRVVEAEIASPTVCASTWRGT--MVTERSLCAG--NRDGSGPCVGDSGGGLMVKQGD--RWLLRG 480
            .:.||..:.....|.:....|  |:|:..:|:|  ...|...|.|||||.|:..:.|  |:...|
  Fly   269 LQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIG 333

  Fly   481 IVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516
            |||.|.    |..:.|...:|..::|:::||.||.|
  Fly   334 IVSWGN----GCARPNYPGVYTRVTKYLDWIVENSR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 74/250 (30%)
Tryp_SPc 277..511 CDD:214473 72/247 (29%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 72/248 (29%)
Tryp_SPc 128..363 CDD:238113 74/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.