DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG18180

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:261 Identity:69/261 - (26%)
Similarity:115/261 - (44%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 GREGSTTPFIVRGNEFPRGQYPWLSAVYHK-------EVRALAFKCRGSLISSSIVISAAHCVHR 325
            |.||.    ||.|...|.|:.|::..::.:       .|.|      |::|::..:::||||   
  Fly    31 GAEGR----IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGA------GTIIANDWILTAAHC--- 82

  Fly   326 MTEDRVVVGLGRYDLDDYGEDGAEMRNVMR--LLWHPDYNTRSYSDADIALITIERPVTFNDII- 387
            :|.|.|.:..|    .::|.:||..:.|.|  .:.|||:  .|....||.||.... |.||.:| 
  Fly    83 LTGDYVEIHYG----SNWGWNGAYRQTVRRDNFISHPDW--PSQGGRDIGLIRTPH-VDFNGLIN 140

  Fly   388 -APICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCA 451
             .|:.....:..|...|.....|||..::.:...:.:.|:.:|.|.:.|...:.....|:  :|.
  Fly   141 KIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTD--MCT 203

  Fly   452 GNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVS----AGERGPAGTCQLNQYVLYCDLSKHINWIS 512
            .:.||...|.|||||.|:.....|  |.|:::    :...||:|         |..:|.::.||.
  Fly   204 RHADGKSVCGGDSGGPLVTHDNAR--LVGVITFASVSCHDGPSG---------YTRVSDYLEWIR 257

  Fly   513 E 513
            :
  Fly   258 D 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 66/252 (26%)
Tryp_SPc 277..511 CDD:214473 64/248 (26%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/253 (25%)
Tryp_SPc 36..259 CDD:238113 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.