DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG8329

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:109/266 - (40%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 GSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCR------GSLISSSIVISAAHCVHRMTED 329
            |.....||.|.....|:.|:          |:..:..      ||:|.::.|::||||   :|.|
  Fly    29 GGPKDIIVNGYPAYEGKAPY----------AVGLRMNNGAVGGGSVIGNNWVLTAAHC---LTTD 80

  Fly   330 RVVVGLGRYDLDDYGEDGA---------EMRNVMRLLWHPDY-NTRSYSDADIALITIERP-VTF 383
            .|.:        .||.:.|         ...|..|   ||.| |:..:   ||.|  |..| |:|
  Fly    81 SVTI--------HYGSNRAWNGQLQHTVNKNNFFR---HPGYPNSAGH---DIGL--IRTPYVSF 129

  Fly   384 NDIIAPICM--WTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTE 446
            .::|..:.:  ::.:..|..:......|||...:.....:.:.::.::.|...||.::.....|:
  Fly   130 TNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGSVASTD 194

  Fly   447 RSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIV---SAG-ERGPAGTCQLNQYVLYCDLSKH 507
              :|....||...|.|||||.|:..  |..:..|::   |.| :.||:|         |..:|.|
  Fly   195 --MCTRATDGKSVCGGDSGGALVTH--DNPIQVGVITFASIGCKSGPSG---------YTRVSDH 246

  Fly   508 INWISE 513
            ::||.|
  Fly   247 LDWIRE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/260 (25%)
Tryp_SPc 277..511 CDD:214473 62/256 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/260 (25%)
Tryp_SPc 35..250 CDD:214473 62/256 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.