DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG3088

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:278 Identity:54/278 - (19%)
Similarity:107/278 - (38%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 ISSVVCG--REGSTTP--FIVRGNEFPRGQYPWLSAVYHKEVRALAFK-----CRGSLISSSIVI 317
            ::.|..|  ::.|..|  .|..|:....||.|:        |..:||.     |.|::|..:.::
  Fly    10 LTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPY--------VVGMAFGQSNIWCSGTIIGDTWIL 66

  Fly   318 SAAHCV------------HRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSY--S 368
            ::|.|:            .|:::.:..|.:|                           |..|  .
  Fly    67 TSAQCLTGSSGVTIYFGATRLSQAQFTVTVG---------------------------TSEYVTG 104

  Fly   369 DADIALITIERPVTFNDIIAPICMWTV--EASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIA 430
            :..:||:.:.| |.|::.:..:.:.::  .:.|..:....:.|||....|: .|...:.|:.:|.
  Fly   105 NQHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIM 168

  Fly   431 SPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQL 495
            |...|.:.:..|.|:::.||.....|...|.||:|..|:.||...     :|.......:..|.|
  Fly   169 SNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDST-----VVGISAFVASNGCTL 228

  Fly   496 NQYVLYCDLSKHINWISE 513
            .....:..::..::||.:
  Fly   229 GLPAGFARITSALDWIHQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 50/259 (19%)
Tryp_SPc 277..511 CDD:214473 48/255 (19%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 50/257 (19%)
Tryp_SPc 29..244 CDD:214473 48/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.