DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:111/296 - (37%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 TPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALA 303
            |.|.:.|  ....|....|.:.:|::.....||. .|:.| |..|..|.:               
  Fly    19 TMPRLAT--EKLTPVHTKDMQGRITNGYPAEEGK-APYTV-GLGFSGGWW--------------- 64

  Fly   304 FKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMR-NVMRLLWHPDYNTRSY 367
              |.||:|:...|::|.||:.  ..|.|.|..           ||..| |.....|..:.|...:
  Fly    65 --CGGSIIAHDWVLTAEHCIG--DADSVTVYF-----------GATWRTNAQFTHWVGNGNFIKH 114

  Fly   368 SDADIALITI------------ERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSS-RT 419
            |.||||||.|            |.| ::||.......|...|          .|||...|.| ..
  Fly   115 SSADIALIRIPHVDFWHMVNKVELP-SYNDRYNDYNEWWAVA----------CGWGGTYDGSPLP 168

  Fly   420 QYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSA 484
            .|.:.|:.:|...:.| |.:.|: |.:..||....||...|.|||||.|:...|.:  |.|:.:.
  Fly   169 DYLQCVDLQIIHNSEC-SGYYGS-VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVTNF 229

  Fly   485 G------ERGPAGTCQLNQYVLYCDLSKHINWISEN 514
            |      ...|||.    |.|.|     |::||.::
  Fly   230 GSVAGCQSGAPAGF----QRVTY-----HLDWIRDH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 71/256 (28%)
Tryp_SPc 277..511 CDD:214473 69/253 (27%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/269 (27%)
Tryp_SPc 40..256 CDD:238113 75/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.