DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and sphinx2

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:120 Identity:32/120 - (26%)
Similarity:46/120 - (38%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 RTVSTTGFIAGWGRDEDSSR-TQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVG 462
            |.|.....:.|||.|:...| ..:.|.||.|:.:.|.||.  ..|.:....:|.......|.|.|
  Fly   139 RYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAK--YHTPLKWYEMCTSGEGFKGVCEG 201

  Fly   463 DSGGGLMVKQ------GDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511
            |.||.::...      |..||:          |. .|.:....::..:|.||.||
  Fly   202 DMGGAVVTMGPNPTFIGIIWLM----------PT-NCSIGYPSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 32/120 (27%)
Tryp_SPc 277..511 CDD:214473 30/118 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 30/118 (25%)
Tryp_SPc 26..248 CDD:304450 32/120 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.