DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and ndl

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:114/264 - (43%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLD 341
            ||.|:.....|:|::.|:|    |...|.|.|::.|...:||||||         |:..|:|..:
  Fly  1145 IVGGSYTSALQWPFVVAIY----RNGKFHCGGTIYSDRWIISAAHC---------VINYGKYFYE 1196

  Fly   342 ---------DYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEA 397
                     .| ....:::.|..::.|..|..||..: |::|:.:..|:.||..:.|||:  .:.
  Fly  1197 VRAGLLRRSSY-SPATQIQPVSHVVVHQAYERRSMRN-DLSLLRLLNPLQFNRWVKPICL--PDK 1257

  Fly   398 SRTV-----------STTGFIAGWG--RDEDSSRTQYPRV---VEAEIASPTVCASTWRGTMVTE 446
            .||.           .|...:.|||  |::..|.....:|   :..:...|...||         
  Fly  1258 GRTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDPEDQAS--------- 1313

  Fly   447 RSLCAGNRDGS-GPCVGDSGGGLM---VKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKH 507
            ..:|||:.||. ..|.|||||.|.   |...|.:.|.|:||.|.    |..:..::.:|..::.:
  Fly  1314 EDICAGDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGN----GCARPQEFGVYTRVTLY 1374

  Fly   508 INWI 511
            ::|:
  Fly  1375 LDWL 1378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/264 (26%)
Tryp_SPc 277..511 CDD:214473 68/262 (26%)
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 68/261 (26%)
Tryp_SPc 1145..1379 CDD:238113 69/264 (26%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.