DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG10472

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:115/273 - (42%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 GSTTPF-------IVRGNEFP---------RGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISA 319
            |.|.|.       |...|:||         .|...|               |.|::||...:|:|
  Fly    39 GETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAW---------------CGGTIISDRWIITA 88

  Fly   320 AHCVHRMTEDRVVVGLGRYDLDDYGEDG-----AEMRNVMRLLWHPDYNTRSYSDADIALITIER 379
            |||...:|.. |.|.||.:|..:..|:|     .|.:||   :.|.|:...:.:: ||:||.:..
  Fly    89 AHCTDSLTTG-VDVYLGAHDRTNAKEEGQQIIFVETKNV---IVHEDWIAETITN-DISLIKLPV 148

  Fly   380 PVTFNDIIAPICMWTVEASRTVSTTG----FIAGWGRDEDSSR-----TQYPRVVEAEIASPTVC 435
            |:.||..|.|..:  ...|.:.||.|    ..:|||:..||:.     .||..|   .|.:.:.|
  Fly   149 PIEFNKYIQPAKL--PVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATV---PIMNNSGC 208

  Fly   436 ASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVL 500
             |.|...:|...::|.....|...|.|||||.|::..|...|    :.|...|.|..|::....:
  Fly   209 -SPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTL----IGATSFGIALGCEVGWPGV 268

  Fly   501 YCDLSKHINWISE 513
            :..::.:::||.|
  Fly   269 FTRITYYLDWIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 72/260 (28%)
Tryp_SPc 277..511 CDD:214473 69/256 (27%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 69/262 (26%)
Tryp_SPc 47..282 CDD:238113 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.