DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:326 Identity:76/326 - (23%)
Similarity:120/326 - (36%) Gaps:82/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VPITFAPPVPTITSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPF 276
            |.:.||..:.|.::...|...|..|... |||..:                       ||.    
  Fly     3 VLVVFALALATASAGLLPQQVPIHPRDL-PAVTNI-----------------------EGR---- 39

  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLD 341
            |..|.....||:|:...:....... ::.|.||:|.::.|::||||....:...:..        
  Fly    40 ITNGKTATSGQFPYQVGLSFASTSG-SWWCGGSIIDNTWVLTAAHCTSGASAVTIYY-------- 95

  Fly   342 DYGEDGAEMRNVMRL---------LWHPDYNTRSYSDADIALI---TIERPVTFNDIIAPICMWT 394
                 ||.:|...:|         :.|..||:....: ||:||   |:......|.:..|....|
  Fly    96 -----GATVRTSAQLVQTVSADNFVQHASYNSIVLRN-DISLIKTPTVAFTALINKVELPAIAGT 154

  Fly   395 VEASRTVSTTGFIAGWGRDEDSSRT-----QYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNR 454
            .  |.........:|||:..||:.:     ||.   ..|:.|.:.|.:|:...:.|...:|....
  Fly   155 Y--STYTGQQAIASGWGKTSDSATSVANTLQYE---VFEVVSVSQCQNTYGSLVATNNVICVATP 214

  Fly   455 DGSGPCVGDSGGGLMVKQGDRWLLRGIV----SAG-ERG-PAGTCQLNQYVLYCDLSKHINWISE 513
            :....|.|||||.|::....:  |.|:.    ||| |.| |||..::..|         ::||..
  Fly   215 NKVSTCNGDSGGPLVLVSDSK--LIGVTSFVSSAGCESGAPAGFTRVTSY---------LDWIKT 268

  Fly   514 N 514
            |
  Fly   269 N 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 63/259 (24%)
Tryp_SPc 277..511 CDD:214473 61/256 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 61/261 (23%)
Tryp_SPc 40..269 CDD:238113 63/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.