DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:128/284 - (45%) Gaps:34/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 AVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKC 306
            |:.....|.|.|: ...||:...||    |.....|..|:....||:|:...:..|.....:..|
  Fly     8 ALAVAASAFPEPE-LRHRSREMPVV----GDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWC 67

  Fly   307 RGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMR---LLWHPDYNTRSYS 368
            .||||.|:.|::||||...:....|.:|.       .....||:.:.:.   ::.|..:|:.:..
  Fly    68 GGSLIGSTWVLTAAHCTDGVQSVTVYLGA-------TVRTSAEITHTVSSSDIIIHSGWNSANLR 125

  Fly   369 DADIALITIERPVTFNDI-IAPICMWTVEASRT--VSTTGFIAGWGRDEDSS-----RTQYPRVV 425
            : ||:||.|  |.|.:.. |:.:.:.::..|.:  |......:||||..|:|     ..||   |
  Fly   126 N-DISLIKI--PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQY---V 184

  Fly   426 EAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPA 490
            :..:.:.|.||.|:..::||:.:||....|....|.|||||.|::|.....:  |:.|.|  ..|
  Fly   185 DLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFG--ASA 245

  Fly   491 GTCQLNQYVLYCDLSKHINWISEN 514
            | |:......:..::.:::||..|
  Fly   246 G-CEKGYPAAFTRVTSYLDWIKTN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 67/247 (27%)
Tryp_SPc 277..511 CDD:214473 65/244 (27%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/245 (27%)
Tryp_SPc 38..268 CDD:238113 67/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.