DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG10477

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:117/262 - (44%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 REGSTTPF----IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTED 329
            |:.|..|.    |..||:....|:|:...:..|. .|.::.|.||:|:::.|::||||....:..
  Fly    28 RDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKS-SAGSWWCGGSIIANTWVLTAAHCTKGASSV 91

  Fly   330 RVVVGLGRYDLDDYG---EDGAEMRNVM---RLLWHPDYNTRSYSDADIALITIERP-VTFNDII 387
            .:.          ||   ...|:::..:   :.:.|..||..:..: ||:|  |:.| |||...|
  Fly    92 TIY----------YGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRN-DISL--IKTPSVTFTVSI 143

  Fly   388 APICMWTVEASRT--VSTTGFIAGWGRDEDSS-----RTQYPRVVEAEIASPTVCASTWRGTMVT 445
            ..|.:..:.:|.:  ...|...:||||..|||     ..||   .:.::.:..||..|:..::||
  Fly   144 NKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQY---AQFQVITNAVCQKTFGSSVVT 205

  Fly   446 ERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVS-AGERGPAGTCQLNQYVLYCDLSKHIN 509
            ...:|..:.:....|.|||||.|.:..    .|.|:.| ...:|    |:.|....:..::.:::
  Fly   206 SGVICVESINKKSTCQGDSGGPLALNN----RLIGVTSFVSSKG----CEKNAPAGFTRVTSYLD 262

  Fly   510 WI 511
            ||
  Fly   263 WI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 64/250 (26%)
Tryp_SPc 277..511 CDD:214473 62/248 (25%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 62/249 (25%)
Tryp_SPc 40..267 CDD:238113 64/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.