DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG32271

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:190 Identity:57/190 - (30%)
Similarity:93/190 - (48%) Gaps:25/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 FKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPD-YNTRSY 367
            |.|.|||::...|::|||||..:...|::|..|...|.:.|     :|:.:..::.|. ||||:.
  Fly    48 FMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTETG-----VRSGVDKVYTPKAYNTRTL 107

  Fly   368 SDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTG---FIAGWGR--DEDSSRTQYPRVVEA 427
            : :|:|::.::.|::...:.      |:|...|....|   .::|||:  :.:.:.:...|.|:.
  Fly   108 T-SDVAVLKLKAPISGPKVS------TIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDV 165

  Fly   428 EIASPTVCASTW--RGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAG 485
            .:.....|.|.:  ||| :|....||........|.|||||. .|.||.   |.||||.|
  Fly   166 ALIPRKACMSQYKLRGT-ITNTMFCASVPGVKDACEGDSGGP-AVYQGQ---LCGIVSWG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 57/190 (30%)
Tryp_SPc 277..511 CDD:214473 57/190 (30%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 57/190 (30%)
Tryp_SPc 25..244 CDD:238113 57/190 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.