DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG3650

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:120/269 - (44%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 QISSVVCG-REGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRAL---AFKCRGSLISSSIVISAAH 321
            |::.::.| ..|...|.||.|..      ..||||....|...   .|.|.|||::||.|::|||
  Fly     9 QLTQLLLGLASGQIQPRIVGGTT------TTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAH 67

  Fly   322 CVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDI 386
            |:......|:.|..|...|...|    .:|.|.| .:.|:..:.|..:.|:.:|.::..:|.:.|
  Fly    68 CLKGYQASRITVQGGVSKLSQSG----VVRRVAR-YFIPNGFSSSSLNWDVGVIRLQSALTGSGI 127

  Fly   387 IA-PIC--MWTVEASRTVSTTGFIAGWG--RDEDSSRTQYPRVVEAEIASPTVCASTWRG-TMVT 445
            .. |:|  .|.......||      |||  |..:||.:...|.|..::....||...::| ..:|
  Fly   128 TTIPLCQVQWNPGNYMRVS------GWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLT 186

  Fly   446 ERSLCA--GNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYV-LYCDLSKH 507
            ..:.||  |.:|.   |.||||||::.|.    .|.||||.|    .| |...||. :|..:.:.
  Fly   187 ASTFCARTGGKDS---CSGDSGGGVIFKN----QLCGIVSWG----LG-CANAQYPGVYTSVHRV 239

  Fly   508 INWISENIR 516
            .::|..:|:
  Fly   240 RSFILRSIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 75/248 (30%)
Tryp_SPc 277..511 CDD:214473 74/245 (30%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 74/246 (30%)
Tryp_SPc 26..243 CDD:238113 74/245 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.